Gene Information

Name : O3K_04175 (O3K_04175)
Accession : YP_006777565.1
Strain : Escherichia coli 2011C-3493
Genome accession: NC_018658
Putative virulence/resistance : Virulence
Product : toxin of the YeeV-YeeU toxin-antitoxin system
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 858063 - 858440 bp
Length : 378 bp
Strand : -
Note : -

DNA sequence :
ATGAATACATTACCCGACACTCACGTACGGGAGGCATCGGGCTGCCCGTCTCCCATCACCATCTGGCAGACACTGCTCAC
CCGACTGCTGGACCAGCACTATGGCCTCACGCTGAATGACACACCGTTCGCTGATGAACGTGTGATTGAGCAGCATATTG
AGGCAGGGATTTCACTGTGTGACGCGGTGAACTTTCTCGTTGAAAAATACGCGCTGGTACGTACCGACCAGCCGGGATTC
AGCGCAGGAGCCCCGTCGCAGTTAATCAACAGCATTGATATTCTCCGGGCACGCCGGGCAACCGGCCTGATGACACGCGA
CAACTACAGAACGGTAAATAACATTACCCTGGGTAAACATCCGGGGGCGAAACAATGA

Protein sequence :
MNTLPDTHVREASGCPSPITIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
yeeV NP_838487.1 hypothetical protein Not tested SHI-1 Protein 1e-53 99
unnamed AAK00482.1 unknown Not tested SHI-1 Protein 8e-54 99
yeeV NP_708773.1 hypothetical protein Not tested SHI-1 Protein 1e-53 99
yeeV YP_854325.1 hypothetical protein Not tested PAI I APEC-O1 Protein 3e-53 96
yeeV AAZ04461.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 2e-52 96
unnamed CAD42101.1 hypothetical protein Not tested PAI II 536 Protein 1e-51 94
Z5091 NP_290242.1 hypothetical protein Not tested LEE Protein 1e-50 94
unnamed AAC31486.1 L0007 Not tested LEE Protein 9e-51 94
ECs4539 NP_312566.1 hypothetical protein Not tested LEE Protein 1e-50 94
unnamed ACU09433.1 conserved hypothetical protein Not tested LEE Protein 9e-51 94
ECO103_3592 YP_003223449.1 hypothetical protein Not tested LEE Protein 2e-52 93
yeeV CAE85204.1 YeeV protein Not tested PAI V 536 Protein 2e-50 93
c5149 NP_756997.1 hypothetical protein Not tested PAI II CFT073 Protein 4e-51 92
unnamed AAL67389.1 L0007-like protein Not tested PAI II CFT073 Protein 3e-51 92
unnamed CAD66207.1 hypothetical protein Not tested PAI III 536 Protein 3e-49 92
unnamed AAL57575.1 unknown Not tested LEE Protein 5e-50 92
z5091 CAD33789.1 Z5091 protein Not tested PAI I 536 Protein 3e-49 92
unnamed CAI43848.1 hypothetical protein Not tested LEE Protein 1e-50 91
aec76 AAW51759.1 Aec76 Not tested AGI-3 Protein 1e-50 91
yeeV ADD91699.1 YeeV Not tested PAI-I AL862 Protein 2e-49 90
unnamed AAL08478.1 unknown Not tested SRL Protein 5e-49 90
unnamed AAL67342.1 intergenic-region protein Not tested PAI II CFT073 Protein 8e-48 88

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
O3K_04175 YP_006777565.1 toxin of the YeeV-YeeU toxin-antitoxin system VFG0663 Protein 3e-54 99
O3K_04175 YP_006777565.1 toxin of the YeeV-YeeU toxin-antitoxin system VFG1620 Protein 4e-52 94
O3K_04175 YP_006777565.1 toxin of the YeeV-YeeU toxin-antitoxin system VFG0786 Protein 4e-51 94
O3K_04175 YP_006777565.1 toxin of the YeeV-YeeU toxin-antitoxin system VFG1530 Protein 1e-49 92
O3K_04175 YP_006777565.1 toxin of the YeeV-YeeU toxin-antitoxin system VFG1682 Protein 1e-49 92
O3K_04175 YP_006777565.1 toxin of the YeeV-YeeU toxin-antitoxin system VFG1069 Protein 2e-49 90