Gene Information

Name : O3K_00410 (O3K_00410)
Accession : YP_006776818.1
Strain : Escherichia coli 2011C-3493
Genome accession: NC_018658
Putative virulence/resistance : Resistance
Product : putative transcriptional regulator MerR
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 71373 - 71807 bp
Length : 435 bp
Strand : -
Note : COG0789 Predicted transcriptional regulators

DNA sequence :
ATGGAAAATAATTTGGAAAACCTGACCATTGGCGTTTTTGCCAAGGCGGCCGGGGTCAACGTGGAGACAATCCGCTTCTA
TCAGCGCAAGGGCCTGTTGCGGGAACCGGACAAGCCTTACGGCAGCATCCGCCGCTATGGGGAGGCGGACGTGGTTCGGG
TGAAATTCGTGAAATCGGCACAGCGGCTGGGGTTCAGTCTGGACGAGATTGCCGAGCTGTTGCGGCTCGACGATGGCACC
CACTGCGAGGAGGCCAGCAGCCTGGCCGAACACAAGCTCAAGGACGTGCGCGAGAAGATGGCCGACTTGGCGCGCATGGA
AACCGTGCTGTCTGAACTCGTGTGCGCCTGCCATGCACGAAAGGGGAATGTTTCCTGCCCGTTGATCGCGTCACTACAGG
GCGAAGCAGGCCTGGCAAGGTCAGCTATGCCTTAG

Protein sequence :
MENNLENLTIGVFAKAAGVNVETIRFYQRKGLLREPDKPYGSIRRYGEADVVRVKFVKSAQRLGFSLDEIAELLRLDDGT
HCEEASSLAEHKLKDVREKMADLARMETVLSELVCACHARKGNVSCPLIASLQGEAGLARSAMP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR ACK44535.1 MerR Not tested SGI1 Protein 2e-63 100
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 2e-63 100
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 3e-63 100
merR AFG30124.1 MerR Not tested PAGI-2 Protein 2e-63 100
merR AGK07083.1 MerR Not tested SGI1 Protein 1e-62 99
merR AGK07025.1 MerR Not tested SGI1 Protein 1e-62 99
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 5e-57 91
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 3e-57 91
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 2e-47 78
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 3e-45 73
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 5e-27 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
O3K_00410 YP_006776818.1 putative transcriptional regulator MerR BAC0686 Protein 3e-56 95
O3K_00410 YP_006776818.1 putative transcriptional regulator MerR BAC0232 Protein 5e-60 94
O3K_00410 YP_006776818.1 putative transcriptional regulator MerR BAC0687 Protein 5e-60 94
O3K_00410 YP_006776818.1 putative transcriptional regulator MerR BAC0688 Protein 7e-58 94
O3K_00410 YP_006776818.1 putative transcriptional regulator MerR BAC0683 Protein 4e-59 91
O3K_00410 YP_006776818.1 putative transcriptional regulator MerR BAC0684 Protein 2e-58 89
O3K_00410 YP_006776818.1 putative transcriptional regulator MerR BAC0689 Protein 4e-55 88