Gene Information

Name : O3K_01410 (O3K_01410)
Accession : YP_006777014.1
Strain : Escherichia coli 2011C-3493
Genome accession: NC_018658
Putative virulence/resistance : Resistance
Product : DNA-binding transcriptional repressor ArsR
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 290270 - 290623 bp
Length : 354 bp
Strand : -
Note : COG0640 Predicted transcriptional regulators

DNA sequence :
ATGTCATTTCTGTTACCCATCCAATTGTTCAAAATTCTTGCTGATGAAACCCGTCTGGGCATCGTTTTACTGCTCAGCGA
ACTGGGAGAGTTATGCGTCTGCGATCTCTGCACTGCTCTCGACCAGTCGCAGCCCAAGATCTCCCGCCACCTGGCATTGC
TGCGTGAAAGCGGGCTATTGCTGGACCGCAAGCAAGGTAAGTGGGTTCATTACCGCTTATCACCGCATATTCCAGCATGG
GCGGCGAAAATTATTGATGAGGCCTGGCGATGTGAACAGGAAAAGGTTCAGGCGATTGTCCGCAACCTGGCTCGACAAAA
CTGTTCCGGGGACAGTAAGAACATTTGCAGTTAA

Protein sequence :
MSFLLPIQLFKILADETRLGIVLLLSELGELCVCDLCTALDQSQPKISRHLALLRESGLLLDRKQGKWVHYRLSPHIPAW
AAKIIDEAWRCEQEKVQAIVRNLARQNCSGDSKNICS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
arsR2 YP_001007630.1 DNA-binding transcriptional repressor ArsR Not tested YAPI Protein 7e-39 75
arsR AFC76435.1 ArsR Not tested AbaR5 Protein 4e-19 50
arsR CAJ77018.1 arsenite inducible repressor Not tested AbaR1 Protein 2e-19 50

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
O3K_01410 YP_006777014.1 DNA-binding transcriptional repressor ArsR BAC0594 Protein 7e-50 100
O3K_01410 YP_006777014.1 DNA-binding transcriptional repressor ArsR BAC0589 Protein 6e-40 77
O3K_01410 YP_006777014.1 DNA-binding transcriptional repressor ArsR BAC0591 Protein 4e-40 75
O3K_01410 YP_006777014.1 DNA-binding transcriptional repressor ArsR BAC0588 Protein 3e-30 71