Name : O3K_09510 (O3K_09510) Accession : YP_006778603.1 Strain : Escherichia coli 2011C-3493 Genome accession: NC_018658 Putative virulence/resistance : Virulence Product : InterPro motifs Prophage CP4-57 regulatory protein (AlpA) Function : - COG functional category : - COG ID : - EC number : - Position : 1994583 - 1994789 bp Length : 207 bp Strand : - Note : COG3311 Predicted transcriptional regulator DNA sequence : ATGGCTACCCCAGTTTCGCTGATGGATGACCAGATGGTCGACATGGCGTTTATCACTCAACTGACCGGCCTAACCGATAA GTGGTTTGACAAACTCATCAAAGATGGGGGCTTTCCTGCGCCCATCAAAATGGGGCGCAGCTCCCGCTGGCTGAAAAGTG AAGTGGAAGCCTGGCTGCAGGCGCGTATTGCACAGTCCCGTCCGTAA Protein sequence : MATPVSLMDDQMVDMAFITQLTGLTDKWFDKLIKDGGFPAPIKMGRSSRWLKSEVEAWLQARIAQSRP |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
unnamed | CAI43835.1 | hypothetical protein | Not tested | LEE | Protein | 5e-25 | 96 |
unnamed | ADD91712.1 | putative transcriptional regulator AlpA | Not tested | PAI-I AL862 | Protein | 5e-25 | 96 |
unnamed | CAE85187.1 | hypothetical protein | Not tested | PAI V 536 | Protein | 3e-25 | 95 |
ECO103_3577 | YP_003223438.1 | transcriptional regulator | Not tested | LEE | Protein | 7e-25 | 93 |
unnamed | AAL08466.1 | unknown | Not tested | SRL | Protein | 9e-25 | 92 |
SF2987 | NP_708761.1 | hypothetical protein | Not tested | SHI-1 | Protein | 2e-24 | 90 |
rox | AAR97599.1 | regulator of excision | Not tested | SHI-1 | Protein | 1e-24 | 90 |
S3190 | NP_838473.1 | hypothetical protein | Not tested | SHI-1 | Protein | 2e-24 | 90 |
unnamed | CAD33739.1 | hypothetical protein | Not tested | PAI I 536 | Protein | 2e-16 | 67 |
c5192 | NP_757040.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 2e-16 | 67 |
Z1188 | NP_286723.1 | hypothetical protein | Not tested | TAI | Protein | 2e-13 | 66 |
Z1627 | NP_287131.1 | hypothetical protein | Not tested | TAI | Protein | 2e-13 | 66 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
O3K_09510 | YP_006778603.1 | InterPro motifs Prophage CP4-57 regulatory protein (AlpA) | VFG1057 | Protein | 4e-25 | 92 |
O3K_09510 | YP_006778603.1 | InterPro motifs Prophage CP4-57 regulatory protein (AlpA) | VFG0651 | Protein | 4e-25 | 90 |
O3K_09510 | YP_006778603.1 | InterPro motifs Prophage CP4-57 regulatory protein (AlpA) | VFG1480 | Protein | 6e-17 | 67 |