Gene Information

Name : O3M_00430 (O3M_00430)
Accession : YP_006767771.1
Strain : Escherichia coli 2009EL-2050
Genome accession: NC_018650
Putative virulence/resistance : Resistance
Product : mercury resistance operon protein MerP
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 71665 - 71940 bp
Length : 276 bp
Strand : +
Note : COG2608 Copper chaperone

DNA sequence :
ATGAAGAAACTGTTTGCCTCCCTTGCCCTCGCCGCCGCTGTTGCCCCGGTGTGGGCCGCTACCCAGACCGTCACGCTAGC
GGTTCCCGGCATGACTTGCGCCGCCTGCCCGATCACAGTCAAGAAAGCGCTCTCCAAGGTCGAAGGCGTGAGCAAGGTCG
ATGTGGGCTTCGAGAAGCGCGAGGCCGTCGTCACTTTTGACGACACCAAGGCCAGCGTACAGAAGCTGACCAAGGCCACC
GCAGACGCCGGCTATCCGTCCAGCGTCAAGCAGTGA

Protein sequence :
MKKLFASLALAAAVAPVWAATQTVTLAVPGMTCAACPITVKKALSKVEGVSKVDVGFEKREAVVTFDDTKASVQKLTKAT
ADAGYPSSVKQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP ABQ57373.1 MerP Not tested SGI1 Protein 7e-25 100
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 7e-25 100
merP AFG30122.1 MerP Not tested PAGI-2 Protein 7e-25 100
merP AGK07023.1 MerP Not tested SGI1 Protein 7e-25 100
merP AGK07081.1 MerP Not tested SGI1 Protein 7e-25 100
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 1e-24 100
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 5e-22 81
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 1e-21 81
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 7e-22 81

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
O3M_00430 YP_006767771.1 mercury resistance operon protein MerP BAC0679 Protein 1e-22 88
O3M_00430 YP_006767771.1 mercury resistance operon protein MerP BAC0678 Protein 7e-23 88
O3M_00430 YP_006767771.1 mercury resistance operon protein MerP BAC0231 Protein 3e-22 85
O3M_00430 YP_006767771.1 mercury resistance operon protein MerP BAC0675 Protein 4e-19 70
O3M_00430 YP_006767771.1 mercury resistance operon protein MerP BAC0674 Protein 8e-16 60