Gene Information

Name : O3M_21850 (O3M_21850)
Accession : YP_006771989.1
Strain : Escherichia coli 2009EL-2050
Genome accession: NC_018650
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4516928 - 4517134 bp
Length : 207 bp
Strand : -
Note : COG3311 Predicted transcriptional regulator

DNA sequence :
ATGGCTACCCCAGTTTCACTGATGGATGACCAGATGGTCGACATGGCATTTATCACTCAACTGACCGGCCTGACAGATAA
GTGGTTTTACAGGCTCATCAGGGATGGGGCCTTTCCGGCTCCCATCAAGCTGGGCCGCAGCTCCCGCTGGCTGAAAAGTG
AAGTGGAAGCCTGGCTGCAGGCGCGTATTGCACAGCCCCGCCCGTAA

Protein sequence :
MATPVSLMDDQMVDMAFITQLTGLTDKWFYRLIRDGAFPAPIKLGRSSRWLKSEVEAWLQARIAQPRP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed AAL08466.1 unknown Not tested SRL Protein 5e-27 100
unnamed CAE85187.1 hypothetical protein Not tested PAI V 536 Protein 3e-26 95
ECO103_3577 YP_003223438.1 transcriptional regulator Not tested LEE Protein 1e-25 93
unnamed CAI43835.1 hypothetical protein Not tested LEE Protein 2e-25 92
unnamed ADD91712.1 putative transcriptional regulator AlpA Not tested PAI-I AL862 Protein 2e-25 92
S3190 NP_838473.1 hypothetical protein Not tested SHI-1 Protein 2e-25 90
SF2987 NP_708761.1 hypothetical protein Not tested SHI-1 Protein 2e-25 90
rox AAR97599.1 regulator of excision Not tested SHI-1 Protein 1e-25 90
Z1188 NP_286723.1 hypothetical protein Not tested TAI Protein 2e-14 68
Z1627 NP_287131.1 hypothetical protein Not tested TAI Protein 2e-14 68
c5192 NP_757040.1 hypothetical protein Not tested PAI II CFT073 Protein 2e-17 67
unnamed CAD33739.1 hypothetical protein Not tested PAI I 536 Protein 1e-17 67

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
O3M_21850 YP_006771989.1 hypothetical protein VFG1057 Protein 2e-27 100
O3M_21850 YP_006771989.1 hypothetical protein VFG0651 Protein 4e-26 90
O3M_21850 YP_006771989.1 hypothetical protein VFG1480 Protein 5e-18 67