Gene Information

Name : MIP_05726 (MIP_05726)
Accession : YP_006730937.1
Strain : Mycobacterium indicus pranii MTCC 9506
Genome accession: NC_018612
Putative virulence/resistance : Resistance
Product : multidrug resistance protein mmr
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4166632 - 4166958 bp
Length : 327 bp
Strand : +
Note : -

DNA sequence :
ATGTTGACCTACCTGTACCTGCTCGGCGCGATCTTCGCGGAAGTGGTGGCGACCAGCCTGCTCAAGAGCACCGAAGGTTT
CTCTCGACTCTGGCCGACCGTGGTTTGCCTGATCGGTTACGCCATCTCGTTCGCGTTGCTGGCGGTCTCGATTTCGCGCG
GCATGCAGACCGACGTCGCCTACGCGTTGTGGTCGGCCATCGGCACGGCCCTCATCGTGTTGATCGCCGTGCTGTTCCTG
GGCTCGTCGATATCGTTGACCAAGGTCGTCGGCGTCGGCCTGATCATCGCGGGTGTCGTCACGCTCAATTTGAGTGGCGC
CCACTGA

Protein sequence :
MLTYLYLLGAIFAEVVATSLLKSTEGFSRLWPTVVCLIGYAISFALLAVSISRGMQTDVAYALWSAIGTALIVLIAVLFL
GSSISLTKVVGVGLIIAGVVTLNLSGAH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 4e-09 44
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 4e-09 44
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 6e-09 44
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 4e-09 44
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 4e-09 44
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 4e-09 44
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 6e-09 44
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 4e-09 44
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 4e-09 44
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 4e-09 44
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 6e-09 44
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 4e-09 44
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 4e-09 44
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 4e-09 44
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 6e-09 44
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 4e-09 44
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 4e-09 44
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 4e-09 44
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 6e-09 44
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 4e-09 44
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 4e-09 44
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 4e-09 44
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 4e-09 44
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 4e-09 44
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 4e-09 44
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 4e-09 44
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 4e-09 44
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 4e-09 44
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 4e-09 44
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 4e-09 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MIP_05726 YP_006730937.1 multidrug resistance protein mmr AE000516.2.gene3301. Protein 3e-30 84
MIP_05726 YP_006730937.1 multidrug resistance protein mmr BAC0249 Protein 3e-30 84
MIP_05726 YP_006730937.1 multidrug resistance protein mmr NC_002695.1.913273.p Protein 5e-13 48
MIP_05726 YP_006730937.1 multidrug resistance protein mmr BAC0150 Protein 5e-13 48
MIP_05726 YP_006730937.1 multidrug resistance protein mmr BAC0322 Protein 2e-09 44
MIP_05726 YP_006730937.1 multidrug resistance protein mmr BAC0323 Protein 2e-09 44
MIP_05726 YP_006730937.1 multidrug resistance protein mmr BAC0329 Protein 7e-12 43
MIP_05726 YP_006730937.1 multidrug resistance protein mmr CP004022.1.gene1549. Protein 1e-09 41
MIP_05726 YP_006730937.1 multidrug resistance protein mmr CP001138.1.gene1489. Protein 2e-09 41