Gene Information

Name : KTR9_4613 (KTR9_4613)
Accession : YP_006671398.1
Strain : Gordonia sp. KTR9
Genome accession: NC_018581
Putative virulence/resistance : Resistance
Product : Putative stree protein, vWFA superfamily
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 5277504 - 5278079 bp
Length : 576 bp
Strand : +
Note : -

DNA sequence :
ATGGGCGTGAGCCTGAGCAAGGGCGGAAACGTTTCCCTCAGCAAGGAGGCTCCGGGCCTGACTGCGGTCTCCGTCGGCCT
CGGCTGGGACATCCGTACCACGACCGGCACCGACTTCGATCTGGATGCGAGCGCCATCGCGCTGAACTCCAGCAAGAAGG
TCCTGTCCGATCAGCACTTCATCTTCTTCAACAACCTCCGCTCCCCCGACGGTTCCATCGAGCATCTCGGTGACAACCTG
ACCGGTGAGGGCGAGGGCGACGACGAGGTCATCAAGGTCGACCTCGCGGGCGTGCCGCCGGAGATCGACTCCATCATCTT
CCCCGTGTCGATCTACGACGCCGACGCTCGCTCGCAGTCCTTCGGCCAGGTCCGCAATGCGTTCATCCGCGTCGTGAACC
AGGCCGGCGGCGCCGAGATCGCCCGCTACGACCTCAGCGAGGATGCCTCCACCGAAACCGCGATGGTCTTCGGCGAGCTG
TACCGTCATGGGTCGGAGTGGAAGTTCCGCGCGGTCGGCCAGGGCTACGCCTCGGGTCTTGCGGGCATCGCCCGCGATTT
CGGTGTGAACGTCTGA

Protein sequence :
MGVSLSKGGNVSLSKEAPGLTAVSVGLGWDIRTTTGTDFDLDASAIALNSSKKVLSDQHFIFFNNLRSPDGSIEHLGDNL
TGEGEGDDEVIKVDLAGVPPEIDSIIFPVSIYDADARSQSFGQVRNAFIRVVNQAGGAEIARYDLSEDASTETAMVFGEL
YRHGSEWKFRAVGQGYASGLAGIARDFGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-60 67
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-58 67
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-59 67
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-59 67
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-59 66
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-59 66
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-59 66
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 8e-56 64
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 1e-31 43
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-28 42
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-28 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
KTR9_4613 YP_006671398.1 Putative stree protein, vWFA superfamily BAC0389 Protein 4e-58 65
KTR9_4613 YP_006671398.1 Putative stree protein, vWFA superfamily BAC0390 Protein 2e-58 62
KTR9_4613 YP_006671398.1 Putative stree protein, vWFA superfamily BAC0392 Protein 8e-28 41