Gene Information

Name : KTR9_3963 (KTR9_3963)
Accession : YP_006670754.1
Strain : Gordonia sp. KTR9
Genome accession: NC_018581
Putative virulence/resistance : Virulence
Product : ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase component
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4556536 - 4557366 bp
Length : 831 bp
Strand : +
Note : -

DNA sequence :
ATGACCGCGTCCTCCCTCGAAACCTCGGCTACCACCGCGCGATTGCGCGGCGTCGGCCTCACCGTCGGCTACGACGAACG
GATCGTCATCGACGGCCTGGACATCGACATCCCCGACGGGCAGGTCACCACGATCATCGGCTCGAATGGATGCGGCAAGT
CGACGCTGCTGCGGTGTCTCGCGCGTCTGCTGCCGCCCCGGGCGGGCACGGTCTACCTCGACGGTGACGACATCTCGTCG
GTTCGCCCCAAACAGGTCGCCCGCACCCTCGCGATCCTGCCCCAGAATCCCATCGCGCCCGAAGGACTCACCGTCGCCGA
CCTGGTCGGGCGCGGACGTCATCCGCACCAGCGCTGGTTCGCGCAGGCCAGCGCGGCCGACGAGGCCGCGGTCGCGCAGG
CGATGGAGATGACCGACACCCTCGACCTCGCCGACCGCACCCTCGACGCCCTGTCGGGCGGGCAGCGGCAACGGGTCTGG
ATCGCGCTGACCCTGGCCCAGGACACCGATCTCATCCTGCTCGACGAGCCGACGACCTACCTGGACCTCGCGCACTCCAT
CGACGTCCTCGACCTGGTCCGCAAGCTCCGCGACGAGCACGGCAAGACCGTCGTCATGGTGCTGCACGATCTCAATCTGG
CTGCGCGGTACAGTGATTCGCTGTTCGTCATGCGCAACGGCGCGATCGTCACCACCGGCTCACCCAGCGAGGTCATCGAC
GCCGAGACCCTCGACGCGGCCTTCGGCCTCCGGGCGCACGTCATGACCGATCCGGTCACCGGCGGCCCGCTCATCGTGCC
GCTGGACTCGCGGACCCACGCCAAGTCGTGA

Protein sequence :
MTASSLETSATTARLRGVGLTVGYDERIVIDGLDIDIPDGQVTTIIGSNGCGKSTLLRCLARLLPPRAGTVYLDGDDISS
VRPKQVARTLAILPQNPIAPEGLTVADLVGRGRHPHQRWFAQASAADEAAVAQAMEMTDTLDLADRTLDALSGGQRQRVW
IALTLAQDTDLILLDEPTTYLDLAHSIDVLDLVRKLRDEHGKTVVMVLHDLNLAARYSDSLFVMRNGAIVTTGSPSEVID
AETLDAAFGLRAHVMTDPVTGGPLIVPLDSRTHAKS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
iusE YP_005143742.1 iron ABC transporter ATP-binding protein Virulence Not named Protein 2e-57 58
fagC YP_005680307.1 ATP binding cytoplasmic membrane protein Not tested PiCp 1 Protein 6e-48 49
fagC YP_003782430.1 ABC transporter ATP-binding protein Not tested PiCp 1 Protein 6e-48 49
fagC YP_005682397.1 ATP binding cytoplasmic membrane protein Virulence PiCp 1 Protein 6e-48 49
fagC YP_005684488.1 ATP binding cytoplasmic membrane protein Not tested PiCp 1 Protein 6e-48 49
fecE AAL08451.1 ATP-binding protein FecE Virulence SRL Protein 2e-41 48
SP_1035 NP_345510.1 iron-compound ABC transporter ATP-binding protein Not tested PPI-1 Protein 4e-52 46
SPN23F_09560 YP_002510939.1 ferric siderophore ABC transporter ATP-binding protein Virulence PPI-1 Protein 4e-52 46
DIP0585 NP_938961.1 iron ABC transporter ATP-binding protein Virulence Not named Protein 1e-40 44
ciuD YP_003783391.1 iron ABC transporter ATP-binding protein Virulence PiCp 4 Protein 1e-39 42
ciuD YP_005685432.1 Iron ABC transporter ATP-binding protein Virulence PiCp 4 Protein 1e-39 42
ciuD YP_005681255.1 Iron ABC transporter ATP-binding protein Virulence PiCp 4 Protein 1e-39 42
ciuD YP_005683346.1 Iron ABC transporter ATP-binding protein Virulence PiCp 4 Protein 1e-39 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
KTR9_3963 YP_006670754.1 ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase component BAC0164 Protein 1e-41 48

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
KTR9_3963 YP_006670754.1 ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase component VFG0925 Protein 7e-51 51
KTR9_3963 YP_006670754.1 ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase component VFG1042 Protein 1e-41 48