Gene Information

Name : BPC006_I1883 (BPC006_I1883)
Accession : YP_006652665.1
Strain :
Genome accession: NC_018527
Putative virulence/resistance : Virulence
Product : quaternary ammonium compound-resistance protein QacE
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1823941 - 1824279 bp
Length : 339 bp
Strand : +
Note : -

DNA sequence :

ATGCAACTTCCAGGTTACGCATGGCTCGCGATCGCGATCGTCGCCGAGGTGGTCGGCACGTCGGCGCTGCGCGCAGCCGA
AGGTTTCACGCGGCTCTGGCCGACGCTCGTCGTCGCCCTCGGCTACGGCACCGCGTTCTACTGCCTGTCGCTCACGCTCA
AGAGCATGCCCGTCGGCATCGTGTACGCGATCTGGTCGGGCGCGGGCATCGTGCTCATCACGCTCGTCGCGCTCGTGCTC
TATCGGCAGGTGCCGGACTGGCCCGCGGTCGTCGGGCTCGCGCTCATCGTCGCGGGCGTCGTGGTGCTCAATCTCTTTTC
GAAAATGCAGGCGCATTGA

Protein sequence :

MQLPGYAWLAIAIVAEVVGTSALRAAEGFTRLWPTLVVALGYGTAFYCLSLTLKSMPVGIVYAIWSGAGIVLITLVALVL
YRQVPDWPAVVGLALIVAGVVVLNLFSKMQAH

• Homologs from PAI DB

Gene	GenBank Accn	Product	Virulance or Resistance	PAI or REI	Alignment Type	E-val	Identity
unnamed	CAD42067.1	hypothetical protein	Not tested	PAI II 536	Protein	8e-17	41

• Homologs from CARD and BacMet (resistance genes)

Gene	GenBank Accn	Product	ID of source DB	Alignment Type	E-val	Identity
BPC006_I1883	YP_006652665.1	quaternary ammonium compound-resistance protein QacE	BAC0377	Protein	8e-22	60
BPC006_I1883	YP_006652665.1	quaternary ammonium compound-resistance protein QacE	BAC0322	Protein	2e-15	58
BPC006_I1883	YP_006652665.1	quaternary ammonium compound-resistance protein QacE	BAC0002	Protein	4e-16	55
BPC006_I1883	YP_006652665.1	quaternary ammonium compound-resistance protein QacE	NC_010410.6003348.p0	Protein	4e-16	55
BPC006_I1883	YP_006652665.1	quaternary ammonium compound-resistance protein QacE	CP004022.1.gene1549.	Protein	2e-15	50
BPC006_I1883	YP_006652665.1	quaternary ammonium compound-resistance protein QacE	CP001138.1.gene1489.	Protein	7e-14	50
BPC006_I1883	YP_006652665.1	quaternary ammonium compound-resistance protein QacE	BAC0249	Protein	6e-10	50
BPC006_I1883	YP_006652665.1	quaternary ammonium compound-resistance protein QacE	AE000516.2.gene3301.	Protein	6e-10	50
BPC006_I1883	YP_006652665.1	quaternary ammonium compound-resistance protein QacE	NC_002695.1.913273.p	Protein	5e-12	49
BPC006_I1883	YP_006652665.1	quaternary ammonium compound-resistance protein QacE	BAC0150	Protein	5e-12	47
BPC006_I1883	YP_006652665.1	quaternary ammonium compound-resistance protein QacE	BAC0327	Protein	2e-16	47

• Homologs from VFDB (virulence genes)

Gene	GenBank Accn	Product	ID of source DB	Alignment Type	E-val	Identity
BPC006_I1883	YP_006652665.1	quaternary ammonium compound-resistance protein QacE	VFG1586	Protein	3e-17	41