
|
Name : PCC21_021730 (PCC21_021730) Accession : YP_006646829.1 Strain : Pectobacterium carotovorum PCC21 Genome accession: NC_018525 Putative virulence/resistance : Virulence Product : transcriptional regulator Function : - COG functional category : - COG ID : - EC number : - Position : 2459313 - 2459510 bp Length : 198 bp Strand : - Note : - DNA sequence : ATGAATAACAACCAACGCATTCTCCGTAAAAAAGAAGTCCTGAGCCGTACAGGTATCTCTAATGCCACCCTTTACCGACT CATCGCGAAAGAATTGTTTCCAGCACAGAGAAAATTGACTGGCGCTGAAGGTCGCGCTGTCGGATGGCTTGATTCAGATA TCAACGACTGGATCAGCAGCCGCGGGCAGACGCTGTAA Protein sequence : MNNNQRILRKKEVLSRTGISNATLYRLIAKELFPAQRKLTGAEGRAVGWLDSDINDWISSRGQTL |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| VC0497 | NP_230151.1 | transcriptional regulator | Not tested | VSP-2 | Protein | 1e-06 | 44 |
| VC1809 | NP_231443.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 2e-09 | 44 |
| VC0395_A1406 | YP_001217349.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 2e-09 | 44 |
| VPI2_0041 | ACA01856.1 | predicted transcriptional regulator | Not tested | VPI-2 | Protein | 1e-09 | 44 |
| ORF C109 | AAN62202.1 | phage-related protein | Not tested | PAGI-2(C) | Protein | 9e-06 | 41 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| PCC21_021730 | YP_006646829.1 | transcriptional regulator | VFG1141 | Protein | 6e-10 | 44 |