Gene Information

Name : B005_2071 (B005_2071)
Accession : YP_006641174.1
Strain : Nocardiopsis alba ATCC BAA-2165
Genome accession: NC_018524
Putative virulence/resistance : Virulence
Product : two component system regulatory protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2169846 - 2170505 bp
Length : 660 bp
Strand : -
Note : -

DNA sequence :
TTGAGTCGCGTACTCATCGTCGAGGACGAGGAACGGATCGCCTCGTTCGTCCGCAAGGGGCTGACCGCCAACGGGTTCGC
CACCACCGTGGTGGGGACCGGGGCCGACGCGGTCGACTACGCCGTCACCGGCGGCTTCGACCTGATGTTGTTGGACCTGG
GGCTGCCGGACACCGATGGTTTCGACGTCCTGCGTCGGCTCCGGGCCATGGGGGTGGATCTGCCCGTGGTGATCCTGACC
GCCCGGGACGGGGTGCGCGACACCGTGACCGGGTTGGAGATCGGGGCGGACGACTACGTCACCAAACCGTTCCGCTTCGA
GGAGCTGCTGGCGCGGGTCCGGCTGCGGATGCGCAACGAGCGCACGGCCGACCTGACGGTACTGCGCGTCGGAGACCTGT
CACTGGACCTGAGGACCCGTCGGGTGTCGGTGGAGGAGGCCACGGTGGACCTGACCGCGCGCGAGTTCGCTCTGTTGGAA
CTGCTCATGCGCCATCCGGGGCAGGTGATGACCCGACAGCAGATGTTGTCGCACGTGTGGGGCTACGACTACGACCCCGG
TTCCAACGTGGTGGACGTGTTCGTGCGCGCCCTGCGTCGCAAGGTGGGCGCGGAGCGGATCGTGACGGTGCGGGGCATGG
GGTACCGGCTGACCGGCTGA

Protein sequence :
MSRVLIVEDEERIASFVRKGLTANGFATTVVGTGADAVDYAVTGGFDLMLLDLGLPDTDGFDVLRRLRAMGVDLPVVILT
ARDGVRDTVTGLEIGADDYVTKPFRFEELLARVRLRMRNERTADLTVLRVGDLSLDLRTRRVSVEEATVDLTAREFALLE
LLMRHPGQVMTRQQMLSHVWGYDYDPGSNVVDVFVRALRRKVGAERIVTVRGMGYRLTG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-32 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-31 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
B005_2071 YP_006641174.1 two component system regulatory protein BAC0197 Protein 2e-35 49
B005_2071 YP_006641174.1 two component system regulatory protein BAC0083 Protein 5e-37 46
B005_2071 YP_006641174.1 two component system regulatory protein BAC0125 Protein 9e-36 45
B005_2071 YP_006641174.1 two component system regulatory protein BAC0638 Protein 7e-28 45
B005_2071 YP_006641174.1 two component system regulatory protein HE999704.1.gene1528. Protein 1e-26 43
B005_2071 YP_006641174.1 two component system regulatory protein BAC0308 Protein 2e-33 43
B005_2071 YP_006641174.1 two component system regulatory protein BAC0347 Protein 3e-29 42
B005_2071 YP_006641174.1 two component system regulatory protein BAC0111 Protein 2e-32 41
B005_2071 YP_006641174.1 two component system regulatory protein AE000516.2.gene3505. Protein 1e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
B005_2071 YP_006641174.1 two component system regulatory protein VFG1389 Protein 1e-31 45
B005_2071 YP_006641174.1 two component system regulatory protein VFG0596 Protein 2e-32 43
B005_2071 YP_006641174.1 two component system regulatory protein VFG1390 Protein 5e-34 43
B005_2071 YP_006641174.1 two component system regulatory protein VFG0473 Protein 7e-26 42
B005_2071 YP_006641174.1 two component system regulatory protein VFG1386 Protein 2e-30 41