Gene Information

Name : A79E_2608 (A79E_2608)
Accession : YP_006636403.1
Strain : Klebsiella pneumoniae 1084
Genome accession: NC_018522
Putative virulence/resistance : Resistance
Product : multiple antibiotic resistance protein MarA
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2764436 - 2764810 bp
Length : 375 bp
Strand : +
Note : -

DNA sequence : 
ATGTCCAGACGTAATAATGACGCCATCACTATCCATAGTATTTTGTCGTGGATCGAGGATAACCTGGAATCGCCCCTGTC
GCTGGAAAAAGTGTCTGAGCGCTCCGGTTACTCTAAGTGGCACCTGCAACGTATGTTTAAGAAAGAGACCGGCCATTCCC
TCGGCCAGTACATCCGCAGCCGCAAGCTGACGGAGATTGCGCAGAAGCTCAAGCAGAGCAATGAGCCAATCCTGTACCTG
GCGGAACGCTATGGTTTCGAGTCGCAGCAGACCCTGACGCGAACGTTCAAGAACTATTTCGATGTTCCGCCCCACAAGTA
TCGCATAACGAATGTACCTGGCGAATCCCGCTATCTACATCCGCTAAATAACTGA

Protein sequence : 
MSRRNNDAITIHSILSWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKLTEIAQKLKQSNEPILYL
AERYGFESQQTLTRTFKNYFDVPPHKYRITNVPGESRYLHPLNN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 3e-21 47
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 3e-21 47
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 2e-19 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
A79E_2608 YP_006636403.1 multiple antibiotic resistance protein MarA CP000647.1.gene1624. Protein 9e-55 100
A79E_2608 YP_006636403.1 multiple antibiotic resistance protein MarA CP001918.1.gene2033. Protein 1e-52 95
A79E_2608 YP_006636403.1 multiple antibiotic resistance protein MarA CP001138.1.gene1637. Protein 1e-51 93
A79E_2608 YP_006636403.1 multiple antibiotic resistance protein MarA NC_002695.1.917339.p Protein 1e-52 93
A79E_2608 YP_006636403.1 multiple antibiotic resistance protein MarA BAC0560 Protein 1e-52 93
A79E_2608 YP_006636403.1 multiple antibiotic resistance protein MarA CP000034.1.gene1596. Protein 2e-52 92
A79E_2608 YP_006636403.1 multiple antibiotic resistance protein MarA NC_010558.1.6276025. Protein 1e-21 47
A79E_2608 YP_006636403.1 multiple antibiotic resistance protein MarA CP001138.1.gene612.p Protein 2e-22 46
A79E_2608 YP_006636403.1 multiple antibiotic resistance protein MarA BAC0371 Protein 7e-20 43
A79E_2608 YP_006636403.1 multiple antibiotic resistance protein MarA CP000034.1.gene4505. Protein 1e-19 43
A79E_2608 YP_006636403.1 multiple antibiotic resistance protein MarA NC_002695.1.914293.p Protein 7e-20 43
A79E_2608 YP_006636403.1 multiple antibiotic resistance protein MarA CP001138.1.gene4488. Protein 7e-20 43
A79E_2608 YP_006636403.1 multiple antibiotic resistance protein MarA CP001918.1.gene327.p Protein 5e-20 43
A79E_2608 YP_006636403.1 multiple antibiotic resistance protein MarA CP000647.1.gene4499. Protein 1e-19 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
A79E_2608 YP_006636403.1 multiple antibiotic resistance protein MarA VFG1038 Protein 1e-21 47
A79E_2608 YP_006636403.1 multiple antibiotic resistance protein MarA VFG0585 Protein 6e-20 43