Gene Information

Name : yceD (B657_02900)
Accession : YP_006628475.1
Strain : Bacillus subtilis QB928
Genome accession: NC_018520
Putative virulence/resistance : Resistance
Product : stress adaptation protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 312792 - 313373 bp
Length : 582 bp
Strand : +
Note : -

DNA sequence :
ATGACAATTTCATTGGCAAAAGGACAAAAAGTAGATTTAACAAAAACAAATCCGGGTCTTTCAAAGGTTGTTGTCGGTTT
AGGCTGGGATACGAACAAGTATGACGGCGGGCACGACTTTGATCTTGACTCAAGTGTGTTTCTGTTAGACGCCGCGGGCA
AATGCGCGTCACCAAACGACTTTATTTTCTACAACCAGCTTGAAGGCGGCAACGGTTCAGTCGTTCATTCAGGCGACAAC
CTGACTGGTGCTGGCGAAGGCGACGATGAGAATGTAAAAGTAAATCTCAGCGCTGTACCGGCAAACATTGATAAAATCTC
ATTTGTTATTACCATTCACGATGCAGAAGCGCGCAGCCAAAACTTTGGACAAGTATCAAACGCGTTTGTCCGCATCGTAA
ATGAAGAAACAAATGAAGAGCTCATCCGTTACGATCTTGCAGAAGATTTCTCTATTGAAACGGCAATCATTGCAGGGGAG
CTTTACAGACATAACGGCGAGTGGAAATTCTCAGCAATCGGCTCAGGCTACCAAGGCGGCCTTGCCCGCATTGCAACAGA
CTACGGTTTGCAAGTCGGTTAA

Protein sequence :
MTISLAKGQKVDLTKTNPGLSKVVVGLGWDTNKYDGGHDFDLDSSVFLLDAAGKCASPNDFIFYNQLEGGNGSVVHSGDN
LTGAGEGDDENVKVNLSAVPANIDKISFVITIHDAEARSQNFGQVSNAFVRIVNEETNEELIRYDLAEDFSIETAIIAGE
LYRHNGEWKFSAIGSGYQGGLARIATDYGLQVG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-49 58
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-49 58
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-50 58
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 3e-49 57
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-40 52
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-40 52
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 7e-41 52
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 6e-41 52
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-24 41
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-24 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yceD YP_006628475.1 stress adaptation protein BAC0389 Protein 1e-49 59
yceD YP_006628475.1 stress adaptation protein BAC0390 Protein 3e-44 53
yceD YP_006628475.1 stress adaptation protein BAC0392 Protein 5e-25 41