Gene Information

Name : Desmer_1530 (Desmer_1530)
Accession : YP_006621394.1
Strain : Desulfosporosinus meridiei DSM 13257
Genome accession: NC_018515
Putative virulence/resistance : Resistance
Product : copper chaperone
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1606653 - 1606853 bp
Length : 201 bp
Strand : +
Note : PFAM: Heavy-metal-associated domain

DNA sequence :

ATGAGTCAAACTATTCTAAAGGTTGAAGGGATGACCTGCAACCACTGTAAAATGAGAGCAGAAAAAGCTTTACAGGCAGT
GAGTGGTGTAGAAAGCGTAAAAGTTGATCTTGCGGCTAAGGAAGCGGTTGTAACTGGTGAGGCTAAGCGCGAGAATTTGG
TTAAAGCAATCGTAGATGCTGGGTATACTGTCGTTGAATAA

Protein sequence :

MSQTILKVEGMTCNHCKMRAEKALQAVSGVESVKVDLAAKEAVVTGEAKRENLVKAIVDAGYTVVE

• Homologs from PAI DB

Gene	GenBank Accn	Product	Virulance or Resistance	PAI or REI	Alignment Type	E-val	Identity
merP	YP_006098389.1	mercuric ion transport protein	Not tested	Tn2411	Protein	2e-06	44
merP	ABQ57373.1	MerP	Not tested	SGI1	Protein	2e-06	44
merP	AET25399.1	MerP	Not tested	PAGI-2(C)	Protein	2e-06	44
merP	AFG30122.1	MerP	Not tested	PAGI-2	Protein	2e-06	44
merP	AGK07023.1	MerP	Not tested	SGI1	Protein	2e-06	44
merP	AGK07081.1	MerP	Not tested	SGI1	Protein	2e-06	44

• Homologs from CARD and BacMet (resistance genes)

Gene	GenBank Accn	Product	ID of source DB	Alignment Type	E-val	Identity
Desmer_1530	YP_006621394.1	copper chaperone	BAC0231	Protein	1e-06	43
Desmer_1530	YP_006621394.1	copper chaperone	BAC0675	Protein	6e-06	43
Desmer_1530	YP_006621394.1	copper chaperone	BAC0678	Protein	1e-06	41