Gene Information

Name : Desmer_1161 (Desmer_1161)
Accession : YP_006621049.1
Strain : Desulfosporosinus meridiei DSM 13257
Genome accession: NC_018515
Putative virulence/resistance : Resistance
Product : stress response protein, TerZ- and CABP1
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1202735 - 1203313 bp
Length : 579 bp
Strand : +
Note : PFAM: Bacterial stress protein

DNA sequence :
ATGGCAATTAGTTTGCAAAAAGGTCAAAAAGTGGATCTTACCAAATCAAATCCCGGGCTTACAAAAATCATTGTTGGTCT
GGGCTGGGATGTTAACAAGTATGATGGCGGAAAAGACTTTGATTTAGATTCTTCAGTTTTCATGCTTAGTGCTGAGGGAA
AAGTTACTGACGAAAAGAACTTTGTCTTCTTTAATAATCCCAAGAGTCCCGATGGTTCAGTGACCCATACCGGTGACAAT
CGTTCCGGTGCCGGGGATGGTGATGATGAGCAAATCAAAGTCGATTTAGCCATTGTTTCCAGTAATGTATCCAAGATCAC
TTTCACCATTACAATTCATGAGGCTCAAGAACGGAATCAGAACTTTGGACAAGTATCTAACGCTTACGTACGTGTCCTGA
ACGAAGCTTCAGGGGAAGAGTTAATTCGCTACGACCTAGGAGAAGACTTTTCTATTGAAACAGCCATTGTAGTTGGCGAG
CTTTATCGCAACAATGCAGAATGGAAGTTCAATGCCATTGGCAGTGGTTACCAAAATGGATTAGCCGGACTGTGCAAGGA
TTTTGGTTTAGACGTCTAA

Protein sequence :
MAISLQKGQKVDLTKSNPGLTKIIVGLGWDVNKYDGGKDFDLDSSVFMLSAEGKVTDEKNFVFFNNPKSPDGSVTHTGDN
RSGAGDGDDEQIKVDLAIVSSNVSKITFTITIHEAQERNQNFGQVSNAYVRVLNEASGEELIRYDLGEDFSIETAIVVGE
LYRNNAEWKFNAIGSGYQNGLAGLCKDFGLDV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-57 60
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 7e-51 55
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-54 55
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-54 55
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-53 54
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 9e-50 53
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 9e-50 53
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 6e-50 53

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Desmer_1161 YP_006621049.1 stress response protein, TerZ- and CABP1 BAC0389 Protein 3e-54 55
Desmer_1161 YP_006621049.1 stress response protein, TerZ- and CABP1 BAC0390 Protein 9e-53 54