Gene Information

Name : GEM_5830 (GEM_5830)
Accession : YP_006619908.1
Strain :
Genome accession: NC_018514
Putative virulence/resistance : Unknown
Product : IS66 Orf2 family protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2916666 - 2917010 bp
Length : 345 bp
Strand : +
Note : overlaps another CDS with the same product name

DNA sequence :
ATGATCGGCCTGCCGGCTGGCACTCGCATCTGGATCGCCGCAGGCGTCACCGACATGCGCAGTGGTTTCCCGGCTCTTGC
CGCGAAGGTGCAAGCGGCACTCGAAGAGAATCCGCTCGGCGGCGACGTGTTCATTTTTCGGGGACGTCGCGGCGATCTCG
TAAAAATTCTATGGGCAACCGATGACGGACTATGGCTTCTCGCGAAGCGGCTTTCGCGTGGGCGGTTTATTTGGCCCCAG
GCGGATGGCGGCAAGATCTATCTGACGTCTGCGCAGCTGTCGATGTTGCTGGAAGGCATCGATTGGCGACAGCCCCGTCG
CACGGCCGCATTGTCGATGTTGTAA

Protein sequence :
MIGLPAGTRIWIAAGVTDMRSGFPALAAKVQAALEENPLGGDVFIFRGRRGDLVKILWATDDGLWLLAKRLSRGRFIWPQ
ADGGKIYLTSAQLSMLLEGIDWRQPRRTAALSML

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 5e-31 70
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 3e-35 67
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 3e-35 67
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 3e-35 67
unnamed AAC31493.1 L0014 Not tested LEE Protein 2e-35 67
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 3e-35 67
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 2e-35 67
unnamed AAL99258.1 unknown Not tested LEE Protein 2e-35 67
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 2e-35 67
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 2e-34 67
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 2e-34 67
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 3e-35 66
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 3e-35 66
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 7e-27 66
unnamed AAL08461.1 unknown Not tested SRL Protein 5e-35 65
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 8e-34 65
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 8e-34 65
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 2e-34 64
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 2e-34 64
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 2e-34 64
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 2e-31 60
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 2e-31 60
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 3e-31 59
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 1e-30 59
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 1e-30 59

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GEM_5830 YP_006619908.1 IS66 Orf2 family protein VFG1709 Protein 9e-36 67
GEM_5830 YP_006619908.1 IS66 Orf2 family protein VFG0792 Protein 9e-36 67
GEM_5830 YP_006619908.1 IS66 Orf2 family protein VFG1517 Protein 3e-27 66
GEM_5830 YP_006619908.1 IS66 Orf2 family protein VFG1698 Protein 7e-36 66
GEM_5830 YP_006619908.1 IS66 Orf2 family protein VFG1052 Protein 2e-35 65
GEM_5830 YP_006619908.1 IS66 Orf2 family protein VFG1665 Protein 8e-35 64
GEM_5830 YP_006619908.1 IS66 Orf2 family protein VFG1737 Protein 8e-32 59