Gene Information

Name : BTG_06080 (BTG_06080)
Accession : YP_006602741.1
Strain : Bacillus thuringiensis HD-771
Genome accession: NC_018500
Putative virulence/resistance : Resistance
Product : two-component response regulator VanRB
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1193010 - 1193675 bp
Length : 666 bp
Strand : -
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :

ATGAAAAACTATCATATTCTCGTGGTAGAGGACGATCAAGAAATTCAGGAATTAATTAAACAATTTTTAATGACACAGCA
TTATACAGTGGTAGTCGCTTCAGATGGACTAGAGGGTATGACACAATTTAATAAGCAATCCTTTGATTTAATTCTCCTAG
ATGTCATGATGCCCAATCTTAATGGGTTTGAAGTTTCTAAAATGATTCGAAGTCAGTCAAACGTACCAATTATTATGCTA
ACTGCGTTGGAAGAAGAGGAAGATCAAATGAAAGGATTCGATCTTGGGATCGATGATTATATAACAAAACCCTTTTCATT
TCATGTTTTGATTAGACGAGTCGAAGCTGTACTTAGAAGAAGTTATGATAAAAATGTAAATAATCATTTGATATTTAAAG
AAGTTCGTATCGATGTGGATGCATATAGAGTCTATGTAAATGATGTTGAAATTATATTAACGACAAAAGAGTTTGAAATT
CTACAACTACTATTTCAAAATGAGAGAAAAGTACTTACAAGAGAAAATATCGTAGAGAAGGTTTGGGGGTACGATTATTT
TGGAGAAACACGAATAATTGATACACATATTAAAAACCTACGCAAAAAATTAGCTATCCCTTATATTAAAACAATAAAGG
GTATTGGTTATAAAATTGATGAATAG

Protein sequence :

MKNYHILVVEDDQEIQELIKQFLMTQHYTVVVASDGLEGMTQFNKQSFDLILLDVMMPNLNGFEVSKMIRSQSNVPIIML
TALEEEEDQMKGFDLGIDDYITKPFSFHVLIRRVEAVLRRSYDKNVNNHLIFKEVRIDVDAYRVYVNDVEIILTTKEFEI
LQLLFQNERKVLTRENIVEKVWGYDYFGETRIIDTHIKNLRKKLAIPYIKTIKGIGYKIDE

• Homologs from PAI DB

Gene	GenBank Accn	Product	Virulance or Resistance	PAI or REI	Alignment Type	E-val	Identity
vanRB	YP_001698483.1	regulatory protein	Not tested	Not named	Protein	5e-56	63
vanRB	NP_815956.1	DNA-binding response regulator VanRB	Not tested	Not named	Protein	3e-41	43
vanRB	YP_008394254.1	DNA-binding response regulator VanRB	Not tested	Not named	Protein	1e-39	42

• Homologs from CARD and BacMet (resistance genes)

Gene	GenBank Accn	Product	ID of source DB	Alignment Type	E-val	Identity
BTG_06080	YP_006602741.1	two-component response regulator VanRB	HE999704.1.gene1202.	Protein	1e-46	46
BTG_06080	YP_006602741.1	two-component response regulator VanRB	NC_002952.2859905.p0	Protein	2e-36	44
BTG_06080	YP_006602741.1	two-component response regulator VanRB	NC_002951.3237708.p0	Protein	3e-36	44
BTG_06080	YP_006602741.1	two-component response regulator VanRB	NC_002758.1121668.p0	Protein	3e-36	44
BTG_06080	YP_006602741.1	two-component response regulator VanRB	NC_009641.5332272.p0	Protein	3e-36	44
BTG_06080	YP_006602741.1	two-component response regulator VanRB	NC_013450.8614421.p0	Protein	3e-36	44
BTG_06080	YP_006602741.1	two-component response regulator VanRB	NC_007793.3914279.p0	Protein	3e-36	44
BTG_06080	YP_006602741.1	two-component response regulator VanRB	NC_003923.1003749.p0	Protein	3e-36	44
BTG_06080	YP_006602741.1	two-component response regulator VanRB	NC_007622.3794472.p0	Protein	2e-36	44
BTG_06080	YP_006602741.1	two-component response regulator VanRB	NC_002745.1124361.p0	Protein	3e-36	44
BTG_06080	YP_006602741.1	two-component response regulator VanRB	NC_009782.5559369.p0	Protein	3e-36	44
BTG_06080	YP_006602741.1	two-component response regulator VanRB	AE016830.1.gene2255.	Protein	1e-41	43
BTG_06080	YP_006602741.1	two-component response regulator VanRB	U35369.1.gene1.p01	Protein	1e-41	43
BTG_06080	YP_006602741.1	two-component response regulator VanRB	AF310956.2.orf0.gene	Protein	5e-40	42
BTG_06080	YP_006602741.1	two-component response regulator VanRB	AE015929.1.gene1106.	Protein	1e-28	42
BTG_06080	YP_006602741.1	two-component response regulator VanRB	AF155139.2.orf0.gene	Protein	4e-32	42
BTG_06080	YP_006602741.1	two-component response regulator VanRB	FJ349556.1.orf0.gene	Protein	2e-33	42
BTG_06080	YP_006602741.1	two-component response regulator VanRB	NC_012469.1.7685629.	Protein	1e-34	41
BTG_06080	YP_006602741.1	two-component response regulator VanRB	HE999704.1.gene2815.	Protein	1e-33	41