Gene Information

Name : BCK_24760 (BCK_24760)
Accession : YP_006599030.1
Strain : Bacillus cereus FRI-35
Genome accession: NC_018491
Putative virulence/resistance : Resistance
Product : DNA-binding response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4835897 - 4836574 bp
Length : 678 bp
Strand : -
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
TTGCTACCAAAAATTTTAATAGTAGATGACGATCCACATATTAGAGAACTTGTTTCTGTATTTTTAGAGCGGGAAGGATT
TCAAACATATGAAGCAATTGATGGTCTAGATGCACTTCAAAAAATAAATGAAGTGAAAGTTGATATGGTTATTCTTGATA
TCATGATGCCGAATATGGATGGATTTGATGTATGTTTTGAATTAAGAAAATACTATGATATCCCTATTTTGATGCTAACT
GCTAAAGGAGAAACATCTCAAAAAGTAAAAGGGTTTCATCTTGGTACGGATGATTATCTTGTAAAACCATTTGATCCGAT
AGAACTAGTAGTGAGGGTAAAGGCGTTATTGAAACGTTATCAAATTACTGTGTCGCAATCAATTCAAGTTGGAAATGTAC
TGTTAAACCGTAAAACATTTGAAGTTATAACCGGAGAACAAACGGTTACGTTACCACTAAAAGAATTCGAATTGCTCTTT
ACTTTAGGTTCTAAAGCGGGAAGGACTTGTTCGAGAGAGCAATTAATTGAAGATGTATGGGGATATGATTTTGAAGGGAA
TGAGCGTACACTAGACGTTCATATAAATCGGTTACGTGAGAAGTTCCAAGAAGAGAAGTCGAAATTTAGTATTAAAACGA
TAAGAGGCTTAGGATATCGCTTAGAGGTAAGTAAATGA

Protein sequence :
MLPKILIVDDDPHIRELVSVFLEREGFQTYEAIDGLDALQKINEVKVDMVILDIMMPNMDGFDVCFELRKYYDIPILMLT
AKGETSQKVKGFHLGTDDYLVKPFDPIELVVRVKALLKRYQITVSQSIQVGNVLLNRKTFEVITGEQTVTLPLKEFELLF
TLGSKAGRTCSREQLIEDVWGYDFEGNERTLDVHINRLREKFQEEKSKFSIKTIRGLGYRLEVSK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 1e-35 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BCK_24760 YP_006599030.1 DNA-binding response regulator NC_003923.1003749.p0 Protein 1e-44 44
BCK_24760 YP_006599030.1 DNA-binding response regulator NC_002952.2859905.p0 Protein 1e-44 43
BCK_24760 YP_006599030.1 DNA-binding response regulator NC_009782.5559369.p0 Protein 1e-44 43
BCK_24760 YP_006599030.1 DNA-binding response regulator NC_002951.3237708.p0 Protein 1e-44 43
BCK_24760 YP_006599030.1 DNA-binding response regulator NC_002758.1121668.p0 Protein 1e-44 43
BCK_24760 YP_006599030.1 DNA-binding response regulator NC_007622.3794472.p0 Protein 1e-44 43
BCK_24760 YP_006599030.1 DNA-binding response regulator NC_009641.5332272.p0 Protein 1e-44 43
BCK_24760 YP_006599030.1 DNA-binding response regulator NC_013450.8614421.p0 Protein 1e-44 43
BCK_24760 YP_006599030.1 DNA-binding response regulator NC_007793.3914279.p0 Protein 1e-44 43
BCK_24760 YP_006599030.1 DNA-binding response regulator NC_002745.1124361.p0 Protein 1e-44 43
BCK_24760 YP_006599030.1 DNA-binding response regulator AM180355.1.gene1830. Protein 9e-39 42
BCK_24760 YP_006599030.1 DNA-binding response regulator AF310956.2.orf0.gene Protein 5e-36 42
BCK_24760 YP_006599030.1 DNA-binding response regulator NC_012469.1.7686381. Protein 4e-33 42
BCK_24760 YP_006599030.1 DNA-binding response regulator EU250284.1.orf4.gene Protein 6e-35 41
BCK_24760 YP_006599030.1 DNA-binding response regulator AF162694.1.orf4.gene Protein 1e-33 41
BCK_24760 YP_006599030.1 DNA-binding response regulator HE999704.1.gene2815. Protein 9e-39 41
BCK_24760 YP_006599030.1 DNA-binding response regulator NC_012469.1.7685629. Protein 2e-39 41