Gene Information

Name : BCK_05825 (BCK_05825)
Accession : YP_006595274.1
Strain : Bacillus cereus FRI-35
Genome accession: NC_018491
Putative virulence/resistance : Resistance
Product : tellurium resistance protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1135273 - 1135857 bp
Length : 585 bp
Strand : -
Note : COG2310 Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1

DNA sequence :
ATGGCATCTATTTCTTTAAAAAAGGGACAAAAGGTAGATTTAACAAAAACAAATCCAGGTTTATCAAAAGTACTTGTAGG
GCTTGGCTGGGATACGAACCGTTATGATGGACAAGCTGATTTTGATTTAGATGTTAGTATCTTTTTAGTAGGTGCGAACG
GTAAAGTTTCAGGCGCAGAGGATTTCGTTTTCTATAATAACCCAAAAGGCGCGAATGGTGCTGTAGAGCATTTAGGAGAT
AACAGAACGGGTGAAGGCGAAGGCGATGACGAAGCGATTAAAGTAGATTTGAAAAATGTACCTGCACATATCGAACGTAT
TTGTTTCACAATCACAATTTACGATGGAGAAGGCCGTAGCCAAAACTTTGGTCAAGTTTCTAACTCATTCGTACGTATTG
TAGATGAAGAAAAGAATGCAGAGTTAATTCGTTACGATTTAGGAGAAGATTTCTCCATTGAAACAGCTGTTGTAGTAGGC
GAATTATACCGCCATGCAGGTGATTGGAAGTTCAATGCAATCGGAAGTGGATTCCAAGGTGGATTAGCGTCTCTATGCAA
TAACTTTGGTTTAGATGTAGAGTAA

Protein sequence :
MASISLKKGQKVDLTKTNPGLSKVLVGLGWDTNRYDGQADFDLDVSIFLVGANGKVSGAEDFVFYNNPKGANGAVEHLGD
NRTGEGEGDDEAIKVDLKNVPAHIERICFTITIYDGEGRSQNFGQVSNSFVRIVDEEKNAELIRYDLGEDFSIETAVVVG
ELYRHAGDWKFNAIGSGFQGGLASLCNNFGLDVE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 6e-56 58
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-55 55
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-55 55
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 9e-51 54
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 9e-51 54
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 6e-51 54
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 7e-55 54
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-48 50

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BCK_05825 YP_006595274.1 tellurium resistance protein BAC0389 Protein 1e-55 57
BCK_05825 YP_006595274.1 tellurium resistance protein BAC0390 Protein 2e-53 55