Gene Information

Name : BCK_05820 (BCK_05820)
Accession : YP_006595273.1
Strain : Bacillus cereus FRI-35
Genome accession: NC_018491
Putative virulence/resistance : Resistance
Product : tellurium resistance protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1134614 - 1135192 bp
Length : 579 bp
Strand : -
Note : COG2310 Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1

DNA sequence :
ATGGCTATTCAGTTACAAAAAGGACAGAAAATCGATTTAGGTAAAACAAGCCCTGGCTTAACAAAAGCAGTAATTGGTCT
TGGGTGGGATATTAAGTCTTATGATGGTGGAGCTGATTTCGATTTAGATGCATCTGCCTTTTTATTAGATATGAACGGAA
AATGTACGAAGGAAACTGATTTTATTTTCTATAATAATTTACAGTCTCCTTGTGGATCAGTTTTACATACAGGTGATAAC
CGAACGGGTGAAGGTGAAGGCGACGATGAGCAACTTGTTGTAGATTTGAAGAAAGTTCCAGCAGATGTGCACAAAATTGC
TATTACAGTTACGATTTATGATGCGGAAGGTCGTAGTCAAAACTTTGGACAAGTAGGAAATGCTTTCGTTCGTTTAGCAA
ACGAAGAAACGAATGAAGAAGTTCTTCGCTTCGATTTAGGGGAAGATTTCTCTATCGAAACAGCAGTTGTCTTTTGTGAA
TTATATCGTCATAATGGACAGTGGAAGTTTAATGCAGTAGGAAGTGGATTCCAAGGTGGTTTAGGTGCGCTTGTAAGAGC
GTATGGCTTGGATGCATAG

Protein sequence :
MAIQLQKGQKIDLGKTSPGLTKAVIGLGWDIKSYDGGADFDLDASAFLLDMNGKCTKETDFIFYNNLQSPCGSVLHTGDN
RTGEGEGDDEQLVVDLKKVPADVHKIAITVTIYDAEGRSQNFGQVGNAFVRLANEETNEEVLRFDLGEDFSIETAVVFCE
LYRHNGQWKFNAVGSGFQGGLGALVRAYGLDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-47 63
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-43 57
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-44 57
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-44 57
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 9e-42 54
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-41 54
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-41 54
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-39 54

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BCK_05820 YP_006595273.1 tellurium resistance protein BAC0389 Protein 4e-44 58
BCK_05820 YP_006595273.1 tellurium resistance protein BAC0390 Protein 1e-42 54