Gene Information

Name : MSMEI_3583 (MSMEI_3583)
Accession : YP_006568341.1
Strain : Mycobacterium smegmatis MC2 155
Genome accession: NC_018289
Putative virulence/resistance : Resistance
Product : Small multidrug resistance protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3738313 - 3738648 bp
Length : 336 bp
Strand : +
Note : -

DNA sequence :
GTGCGGAAGTGGGCGTTGCTGTTGGGGGCCGTGGTCGTCGAAGTCACCGCCACACTGTCGCTGCGGGCATCTCAGGATCA
CGCACTCTGGTTGGTGCCGGTCGTCGCCGGATACGTCGCGGCGTTCGTGTTGCTGACGCTCGTGTTGCGTGCCGGCATGC
CCGTCGGTGTGGCCTACGGGATCTGGGGCGCGCTGGGCACCGCCAGCACCGCCGTGCTGGCCGCGCTGCTGTTCGGTGAC
CCGTTCACCTGGCCGATCGTCGCGGGTATCGGGCTGATCATCGCCGGTGTCCTGCTGGTGGAGTTCGGATCCCACGAACG
CGAGGCCCGACCGTGA

Protein sequence :
MRKWALLLGAVVVEVTATLSLRASQDHALWLVPVVAGYVAAFVLLTLVLRAGMPVGVAYGIWGALGTASTAVLAALLFGD
PFTWPIVAGIGLIIAGVLLVEFGSHEREARP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 2e-07 43
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 2e-07 43
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 2e-07 43
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 2e-07 43
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 2e-07 43
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 2e-07 43
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 2e-07 43
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 2e-07 43
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 2e-07 43
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 2e-07 43
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 2e-07 43
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 2e-07 43
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 2e-07 43
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 2e-07 43
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 2e-07 43
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 2e-07 43
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 2e-07 43
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 2e-07 43
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 2e-07 43
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 2e-07 43
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 2e-07 43
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 2e-07 43
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 2e-07 43
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 2e-07 43
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 2e-07 43
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 2e-07 43
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 2e-07 43
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 2e-07 43
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 2e-07 43
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 2e-07 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MSMEI_3583 YP_006568341.1 Small multidrug resistance protein BAC0322 Protein 2e-07 43
MSMEI_3583 YP_006568341.1 Small multidrug resistance protein BAC0323 Protein 7e-08 43
MSMEI_3583 YP_006568341.1 Small multidrug resistance protein BAC0249 Protein 9e-08 41
MSMEI_3583 YP_006568341.1 Small multidrug resistance protein AE000516.2.gene3301. Protein 9e-08 41