Gene Information

Name : mtrA (MSMEI_1835)
Accession : YP_006566602.1
Strain : Mycobacterium smegmatis MC2 155
Genome accession: NC_018289
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1952060 - 1952737 bp
Length : 678 bp
Strand : +
Note : -

DNA sequence :
ATGAGGCAAAGGATCCTTGTCGTCGATGACGACCCGTCACTGGCCGAGATGCTCACCATCGTTCTGCGTGGTGAGGGTTT
CGACACCGCGGTCATCGGCGACGGCAGCCAGGCACTCACCGCTGTCCGGGAGCTCAGGCCGGACCTGGTCCTGCTCGATT
TGATGCTGCCTGGGATGAACGGCATCGATGTGTGCCGTGTGCTGCGCGCCGACTCCGGCGTGCCGATCGTCATGCTGACC
GCCAAGACCGACACCGTCGACGTGGTGCTGGGCCTGGAATCCGGAGCCGACGACTATGTGATGAAGCCGTTCAAGCCGAA
GGAGCTCGTCGCGCGCGTGCGGGCCCGGCTGCGGCGCAACGAGGACGAGCCCGCCGAGATGCTGTCGATCGGTGACGTCG
AGATCGACGTGCCCGCGCACAAGGTGACCCGGCAAGGCGAGCAGATTTCGCTGACACCGCTGGAGTTCGACCTGCTGGTG
GCCCTGGCACGCAAACCACGGCAGGTGTTTACTCGGGATGTGCTGCTCGAACAGGTGTGGGGATACCGTCACCCCGCTGA
CACCCGTTTGGTGAACGTGCATGTCCAGCGGTTGCGGGCAAAGGTGGAGAAAGACCCGGAGAACCCGCAGGTGGTCCTGA
CCGTTCGAGGAGTGGGATACAAGGCCGGACCCCCGTGA

Protein sequence :
MRQRILVVDDDPSLAEMLTIVLRGEGFDTAVIGDGSQALTAVRELRPDLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLT
AKTDTVDVVLGLESGADDYVMKPFKPKELVARVRARLRRNEDEPAEMLSIGDVEIDVPAHKVTRQGEQISLTPLEFDLLV
ALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQRLRAKVEKDPENPQVVLTVRGVGYKAGPP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 9e-29 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_006566602.1 two-component response regulator AE000516.2.gene3505. Protein 7e-84 97
mtrA YP_006566602.1 two-component response regulator NC_002952.2859905.p0 Protein 3e-37 46
mtrA YP_006566602.1 two-component response regulator NC_009641.5332272.p0 Protein 2e-37 46
mtrA YP_006566602.1 two-component response regulator NC_013450.8614421.p0 Protein 2e-37 46
mtrA YP_006566602.1 two-component response regulator NC_007793.3914279.p0 Protein 2e-37 46
mtrA YP_006566602.1 two-component response regulator NC_007622.3794472.p0 Protein 2e-37 46
mtrA YP_006566602.1 two-component response regulator NC_002745.1124361.p0 Protein 2e-37 46
mtrA YP_006566602.1 two-component response regulator NC_009782.5559369.p0 Protein 2e-37 46
mtrA YP_006566602.1 two-component response regulator NC_002951.3237708.p0 Protein 2e-37 46
mtrA YP_006566602.1 two-component response regulator NC_003923.1003749.p0 Protein 2e-37 46
mtrA YP_006566602.1 two-component response regulator NC_002758.1121668.p0 Protein 2e-37 46
mtrA YP_006566602.1 two-component response regulator HE999704.1.gene2815. Protein 3e-31 44
mtrA YP_006566602.1 two-component response regulator AE015929.1.gene1106. Protein 3e-25 43
mtrA YP_006566602.1 two-component response regulator BAC0125 Protein 6e-26 43
mtrA YP_006566602.1 two-component response regulator NC_012469.1.7685629. Protein 7e-32 43
mtrA YP_006566602.1 two-component response regulator BAC0197 Protein 4e-24 42
mtrA YP_006566602.1 two-component response regulator BAC0039 Protein 2e-26 42
mtrA YP_006566602.1 two-component response regulator CP000034.1.gene2186. Protein 2e-26 42
mtrA YP_006566602.1 two-component response regulator NC_002695.1.916589.p Protein 1e-26 42
mtrA YP_006566602.1 two-component response regulator CP001918.1.gene3444. Protein 2e-26 42
mtrA YP_006566602.1 two-component response regulator BAC0111 Protein 6e-22 41
mtrA YP_006566602.1 two-component response regulator NC_012469.1.7686381. Protein 2e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_006566602.1 two-component response regulator VFG1390 Protein 5e-27 43
mtrA YP_006566602.1 two-component response regulator VFG1389 Protein 6e-24 43
mtrA YP_006566602.1 two-component response regulator VFG1702 Protein 4e-29 41