Gene Information

Name : merR (MRBBS_0152)
Accession : YP_006556503.1
Strain : Marinobacter sp. BSs20148
Genome accession: NC_018268
Putative virulence/resistance : Resistance
Product : mercuric resistance operon regulatory protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 160934 - 161371 bp
Length : 438 bp
Strand : -
Note : -

DNA sequence :
ATGTCTAAAAAACAATGCTCAATGACTATCGGTGTACTGGCCAAGGCCGCCGGTATGGGGGTGGAAACCATCCGTTATTA
CCAGCGCAGAGGACTGGTGGCTGAACCTGAAAAACCCTATGGCAGCATTCGTCATTACGACGAGCAGGCATTGGCGCGCC
TTCACTTCATTCGAACCGCCCAATGGTTGGGGTTCAGTCTGGATGAAATCGGAGGGCTGCTTAAGCTGGAAGACGGTGCC
CATTGTGATGAAGCTCGAGTCCTGGCTGAGCGCAAACTGGATGATTTGCGACGCAAGATCGCCGCCTTGCGACAGATGGA
ATCCACTCTGGATAGCCTAGTGGAACGTTGCCGGTGCAGTGAAGACCCGCAGCGATGTCCGATCATTCATTCGCTGCGGG
GTCAACGTGATATCCCGGACGAGGGGATCGAAAGATGA

Protein sequence :
MSKKQCSMTIGVLAKAAGMGVETIRYYQRRGLVAEPEKPYGSIRHYDEQALARLHFIRTAQWLGFSLDEIGGLLKLEDGA
HCDEARVLAERKLDDLRRKIAALRQMESTLDSLVERCRCSEDPQRCPIIHSLRGQRDIPDEGIER

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 2e-38 60
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 1e-35 54
merR AFG30124.1 MerR Not tested PAGI-2 Protein 9e-36 54
merR ACK44535.1 MerR Not tested SGI1 Protein 9e-36 54
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 9e-36 54
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 1e-35 54
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 1e-35 54
merR AGK07025.1 MerR Not tested SGI1 Protein 5e-35 53
merR AGK07083.1 MerR Not tested SGI1 Protein 5e-35 53
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 6e-32 51
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 3e-26 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
merR YP_006556503.1 mercuric resistance operon regulatory protein BAC0688 Protein 5e-37 57
merR YP_006556503.1 mercuric resistance operon regulatory protein BAC0686 Protein 2e-38 55
merR YP_006556503.1 mercuric resistance operon regulatory protein BAC0232 Protein 4e-36 55
merR YP_006556503.1 mercuric resistance operon regulatory protein BAC0687 Protein 4e-36 55
merR YP_006556503.1 mercuric resistance operon regulatory protein BAC0689 Protein 1e-34 55
merR YP_006556503.1 mercuric resistance operon regulatory protein BAC0684 Protein 3e-37 53
merR YP_006556503.1 mercuric resistance operon regulatory protein BAC0683 Protein 2e-37 53
merR YP_006556503.1 mercuric resistance operon regulatory protein BAC0682 Protein 4e-20 44