Gene Information

Name : mprA (AMES_8205)
Accession : YP_006554683.1
Strain : Amycolatopsis mediterranei S699
Genome accession: NC_018266
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 9180094 - 9180786 bp
Length : 693 bp
Strand : -
Note : -

DNA sequence :
ATGCGCATCCTTGTGGTGGACGACGACCGCGCCGTCCGTGAGTCGCTCCGGCGGTCCCTGGAGTTCAACGGCTACCAGGT
CCAGCTGGCCAGTGACGGTGCGCAGGCCCTGGAGGCGATCATCGCCGACCGGCCGGACGCGATGGTGCTGGACGTCATGA
TGCCCCGGCTCGACGGCCTGGAGGTCGCCCGCCGCCTGCGCAGCACCGGTGACGACCTGCCGATCCTGGTGCTCACCGCG
CGCGACACCGTCTCCGACCGGGTGTCCGGGCTGGACGCCGGCGCCGACGACTACCTGCCGAAGCCCTTCGCGCTCGAGGA
GCTGCTCGCCCGGCTGCGGGCGCTGCTGCGCCGCGCCATCCCCGAAGGCCAGAACGGCCAGGCCTCGGAGGCCCTGGCCT
TCGCCGACCTGACCCTCGACCCCGGCACGCGGGAGGTCCGCCGCGGCGGCCGCGAGATCAGCCTGACCCGGACCGAATTC
GCTCTGCTGGAACTGTTCCTTTCCTACCCGAAGCACGTCCTCACGCGGGGCCGGATCCTGGAGGAAGTATGGGGTTACGA
CTTCCCGACGTCGGGCAACGCGCTGGAGGTCTACGTCGGCTACTTGCGCCGCAAGACGGAGGCCGAGGGGGAGCCGAGGC
TGATCCACACGGTGCGGGGAGTGGGGTACGTCCTGAGGGAAACCCCGCCGTGA

Protein sequence :
MRILVVDDDRAVRESLRRSLEFNGYQVQLASDGAQALEAIIADRPDAMVLDVMMPRLDGLEVARRLRSTGDDLPILVLTA
RDTVSDRVSGLDAGADDYLPKPFALEELLARLRALLRRAIPEGQNGQASEALAFADLTLDPGTREVRRGGREISLTRTEF
ALLELFLSYPKHVLTRGRILEEVWGYDFPTSGNALEVYVGYLRRKTEAEGEPRLIHTVRGVGYVLRETPP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-32 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mprA YP_006554683.1 two-component system response regulator BAC0125 Protein 2e-31 44
mprA YP_006554683.1 two-component system response regulator HE999704.1.gene1528. Protein 2e-37 44
mprA YP_006554683.1 two-component system response regulator AE000516.2.gene3505. Protein 1e-32 43
mprA YP_006554683.1 two-component system response regulator BAC0308 Protein 1e-32 42
mprA YP_006554683.1 two-component system response regulator BAC0083 Protein 1e-34 42
mprA YP_006554683.1 two-component system response regulator BAC0197 Protein 3e-29 42
mprA YP_006554683.1 two-component system response regulator NC_012469.1.7685629. Protein 1e-31 41
mprA YP_006554683.1 two-component system response regulator CP001485.1.gene721.p Protein 1e-25 41
mprA YP_006554683.1 two-component system response regulator BAC0111 Protein 3e-35 41
mprA YP_006554683.1 two-component system response regulator NC_012469.1.7686381. Protein 4e-31 41
mprA YP_006554683.1 two-component system response regulator CP004022.1.gene3215. Protein 4e-25 41
mprA YP_006554683.1 two-component system response regulator BAC0638 Protein 5e-28 41
mprA YP_006554683.1 two-component system response regulator CP000034.1.gene3671. Protein 1e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mprA YP_006554683.1 two-component system response regulator VFG1390 Protein 9e-78 81
mprA YP_006554683.1 two-component system response regulator VFG1386 Protein 7e-47 52
mprA YP_006554683.1 two-component system response regulator VFG1389 Protein 3e-44 51
mprA YP_006554683.1 two-component system response regulator VFG0596 Protein 1e-32 42