Gene Information

Name : mtrA (AMES_7874)
Accession : YP_006554352.1
Strain : Amycolatopsis mediterranei S699
Genome accession: NC_018266
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 8802040 - 8802723 bp
Length : 684 bp
Strand : -
Note : -

DNA sequence :
GTGGACATGAAGGCACGTGTTCTCGTGGTCGACGACGACCCCGCCCTCGCGGAGATGCTCACCATCGTGCTCCGTGGGGA
GGGGTTCGACACGGCGGTGGTCGCCGACGGCTCACGCGCGCTTCCCGCGCTGCGTGAGCTGAAACCCGACCTCGTCCTGC
TCGACCTGATGCTGCCCGGGATGAACGGGATCGACGTCTGCAAGGCGATCCGCGCCGAGTCCGGGGTGCCGATCGTCATG
CTCACCGCCAAGAGCGACACCGTCGACATAGTCCTCGGCCTGGAGTCCGGCGCCGACGACTACGTCGTCAAGCCGTTCAA
GCCGAAGGAGCTGGTCGCGCGGGTCCGGGCCCGCATGCGCCGCACCGAGGCCGAGCCGGCGGAATCGCTCACCATCGGCG
ACCTGGCGATCGACGTGCCGGGCCACGAGGTCACGCGCGAAGGCAAGGCCATCCCGCTGACCCCGCTGGAGTTCGACCTG
CTGGTGGCCCTGGCCCGCAAGCCGCGCCAGGTGTTCACCCGCGAGGTGCTGCTCGAGCAGGTGTGGGGCTACCGCCACGC
GGCCGACACCCGGCTGGTGAACGTGCACGTCCAGCGGCTGCGCTCGAAGGTGGAGAAGGACCCGGAACACCCCGAGGTGG
TGTTGACCGTTCGCGGCGTCGGGTACAAGGCCGGCCCGCCGTGA

Protein sequence :
MDMKARVLVVDDDPALAEMLTIVLRGEGFDTAVVADGSRALPALRELKPDLVLLDLMLPGMNGIDVCKAIRAESGVPIVM
LTAKSDTVDIVLGLESGADDYVVKPFKPKELVARVRARMRRTEAEPAESLTIGDLAIDVPGHEVTREGKAIPLTPLEFDL
LVALARKPRQVFTREVLLEQVWGYRHAADTRLVNVHVQRLRSKVEKDPEHPEVVLTVRGVGYKAGPP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-36 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-36 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_006554352.1 two-component system response regulator AE000516.2.gene3505. Protein 1e-77 83
mtrA YP_006554352.1 two-component system response regulator NC_002952.2859905.p0 Protein 7e-43 46
mtrA YP_006554352.1 two-component system response regulator NC_007622.3794472.p0 Protein 7e-43 46
mtrA YP_006554352.1 two-component system response regulator NC_002758.1121668.p0 Protein 7e-43 46
mtrA YP_006554352.1 two-component system response regulator NC_009641.5332272.p0 Protein 7e-43 46
mtrA YP_006554352.1 two-component system response regulator NC_013450.8614421.p0 Protein 7e-43 46
mtrA YP_006554352.1 two-component system response regulator NC_007793.3914279.p0 Protein 7e-43 46
mtrA YP_006554352.1 two-component system response regulator NC_003923.1003749.p0 Protein 6e-43 46
mtrA YP_006554352.1 two-component system response regulator NC_002745.1124361.p0 Protein 7e-43 46
mtrA YP_006554352.1 two-component system response regulator NC_009782.5559369.p0 Protein 7e-43 46
mtrA YP_006554352.1 two-component system response regulator NC_002951.3237708.p0 Protein 7e-43 46
mtrA YP_006554352.1 two-component system response regulator NC_012469.1.7686381. Protein 1e-42 45
mtrA YP_006554352.1 two-component system response regulator BAC0125 Protein 1e-33 45
mtrA YP_006554352.1 two-component system response regulator HE999704.1.gene2815. Protein 2e-39 45
mtrA YP_006554352.1 two-component system response regulator NC_012469.1.7685629. Protein 9e-39 44
mtrA YP_006554352.1 two-component system response regulator AE016830.1.gene1681. Protein 9e-41 42
mtrA YP_006554352.1 two-component system response regulator BAC0197 Protein 4e-30 42
mtrA YP_006554352.1 two-component system response regulator NC_002952.2859858.p0 Protein 2e-35 41
mtrA YP_006554352.1 two-component system response regulator NC_007622.3794948.p0 Protein 2e-35 41
mtrA YP_006554352.1 two-component system response regulator NC_003923.1003417.p0 Protein 2e-35 41
mtrA YP_006554352.1 two-component system response regulator AE015929.1.gene1106. Protein 6e-31 41
mtrA YP_006554352.1 two-component system response regulator NC_013450.8614146.p0 Protein 2e-35 41
mtrA YP_006554352.1 two-component system response regulator NC_002951.3238224.p0 Protein 2e-35 41
mtrA YP_006554352.1 two-component system response regulator NC_007793.3914065.p0 Protein 2e-35 41
mtrA YP_006554352.1 two-component system response regulator NC_002758.1121390.p0 Protein 2e-35 41
mtrA YP_006554352.1 two-component system response regulator NC_010079.5776364.p0 Protein 2e-35 41
mtrA YP_006554352.1 two-component system response regulator BAC0111 Protein 2e-28 41
mtrA YP_006554352.1 two-component system response regulator HE999704.1.gene1528. Protein 3e-31 41
mtrA YP_006554352.1 two-component system response regulator CP000675.2.gene1535. Protein 1e-33 41
mtrA YP_006554352.1 two-component system response regulator BAC0533 Protein 9e-26 41
mtrA YP_006554352.1 two-component system response regulator CP000647.1.gene4257. Protein 9e-26 41
mtrA YP_006554352.1 two-component system response regulator CP001138.1.gene4273. Protein 3e-26 41
mtrA YP_006554352.1 two-component system response regulator BAC0596 Protein 5e-35 41
mtrA YP_006554352.1 two-component system response regulator CP001138.1.gene2239. Protein 5e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_006554352.1 two-component system response regulator VFG1389 Protein 1e-30 46
mtrA YP_006554352.1 two-component system response regulator VFG1390 Protein 4e-33 42
mtrA YP_006554352.1 two-component system response regulator VFG1702 Protein 9e-37 42
mtrA YP_006554352.1 two-component system response regulator VFG1563 Protein 1e-36 41