Gene Information

Name : NJ7G_0592 (NJ7G_0592)
Accession : YP_006539923.1
Strain : Natrinema sp. J7-2
Genome accession: NC_018224
Putative virulence/resistance : Resistance
Product : Heavy metal transport/detoxification protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 538839 - 539036 bp
Length : 198 bp
Strand : -
Note : -

DNA sequence :
ATGAGTCAGACGCTCACCGTCGAAGGAATGTCGTGTGAACACTGCGAACAGACCGTCGCGGACGCGCTCGAGGGCGTCGA
CGGCGTCGAGTCGGTAGCCGTCGATCGGGAGACCGAACAGGCCACCGTCGAGGGAGATGCGGACCCGCAAGCGCTCGTCA
GCGCGGTCGACGAGGCCGGCTACGACGCGTCGGCATAA

Protein sequence :
MSQTLTVEGMSCEHCEQTVADALEGVDGVESVAVDRETEQATVEGDADPQALVSAVDEAGYDASA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP AGK07081.1 MerP Not tested SGI1 Protein 4e-06 43
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 5e-06 43
merP ABQ57373.1 MerP Not tested SGI1 Protein 4e-06 43
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 4e-06 43
merP AFG30122.1 MerP Not tested PAGI-2 Protein 4e-06 43
merP AGK07023.1 MerP Not tested SGI1 Protein 4e-06 43
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 1e-06 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
NJ7G_0592 YP_006539923.1 Heavy metal transport/detoxification protein BAC0678 Protein 1e-06 43
NJ7G_0592 YP_006539923.1 Heavy metal transport/detoxification protein BAC0679 Protein 2e-06 41
NJ7G_0592 YP_006539923.1 Heavy metal transport/detoxification protein BAC0231 Protein 7e-07 41