Gene Information

Name : PSJM300_03550 (PSJM300_03550)
Accession : YP_006523146.1
Strain : Pseudomonas stutzeri DSM 10701
Genome accession: NC_018177
Putative virulence/resistance : Resistance
Product : 3''-adenylyltransferase
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 795391 - 796188 bp
Length : 798 bp
Strand : -
Note : COG1708 Predicted nucleotidyltransferases

DNA sequence :
ATGAACCCATCAGCCCCCAGCGAAATCACCACACAGCTGTCCGGCGCCTGCGCCGTGCTCGAACGTCACCTGGGCGAAAC
GCTGCTGGCAATCCACCTGTTCGGCTCGGCGATCGACGGCGGGCTCAGGCCGCACAGCGACATCGACCTGCTGGTGACCG
TAAGTGCGCCCGTGCCCGACCCGGTACGGCGCTCGCTGATGCTGGATCTGCTGCCGGTTTCGGGCTGGCCCGGCAGCGAC
CCAGCGCGACGCGCGTTGGAAGTCACGCTGCTCGTCAGGGAGCATCTGGTGCCCTGGCGATACCCGCCGCCACGCGAATT
GCAGTTCGGCGAATGGCTGCGTGAAGAACTGGAAACCGGCAGCATTCCGCCCGCCACCCCTGACCCGGATATCGCGATCC
TGCTGACGAAAGCGAGGCAGCACAGCCTGTGTCTGACAGGCACCTCTATCGCCGAGCTGTTCGAGCCCGTCCCACACGAA
GACTTCGCCAAGGCGCTGATGGATACCGTTGCCCAGTGGAACGAGGCGTCGGACTGGCAGGGCGATGAGTGCAACATCGT
GCTGGCGCTGGCCCGCATCTGGTTCAGCGTCGCCACGGGTGCCATCGTGCCCAAGGACGTCGCCGCCTCCTGGGCCCTCG
AGCACCTGCCGCAGGAACACCGCCCCGTTCTGGCCAGCGCACGGGCGGCTTACCTGGGCGATGCCATTCAGGACCTGGTC
GACTGTCCAGAGCAAGTGGCCGCGTTCATACGCCACGTAAAGCGCGTGATCCTGAGTCGTGCTCAAACCGGCCGCTAA

Protein sequence :
MNPSAPSEITTQLSGACAVLERHLGETLLAIHLFGSAIDGGLRPHSDIDLLVTVSAPVPDPVRRSLMLDLLPVSGWPGSD
PARRALEVTLLVREHLVPWRYPPPRELQFGEWLREELETGSIPPATPDPDIAILLTKARQHSLCLTGTSIAELFEPVPHE
DFAKALMDTVAQWNEASDWQGDECNIVLALARIWFSVATGAIVPKDVAASWALEHLPQEHRPVLASARAAYLGDAIQDLV
DCPEQVAAFIRHVKRVILSRAQTGR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
aadA7 AGK06969.1 aminoglycoside adenyltransferase Not tested SGI1 Protein 8e-66 57
aadA7 AGK07015.1 aminoglycoside adenyltransferase Not tested SGI1 Protein 8e-66 57
aadA7 AGK07073.1 aminoglycoside adenyltransferase Not tested SGI1 Protein 8e-66 57
aadA7 AAR21854.1 aminoglycoside (3'')(9) adenylyltransferase; AAD(3'')(9) Not tested SGI1 Protein 8e-66 57
aadA7 AAT37846.1 aminoglycoside adenyltransferase Not tested Class I integron Protein 8e-66 57
aadA7 AGF35062.1 aminoglycoside adenyltransferase Not tested SGI1 Protein 8e-66 57
aadA7 AGK06932.1 aminoglycoside adenyltransferase Not tested SGI1 Protein 8e-66 57
aadDA1 CAJ77087.1 Aminoglycoside 3-adenylyltransferase Not tested AbaR1 Protein 2e-64 53
aadA1 ACV89835.1 AadA1 aminoglycoside (3')(9) adenylyltransferase Not tested AbaR7 Protein 2e-64 53
unnamed AFV53113.1 AadA1 aminoglycoside (3') adenyltransferase Not tested AbGRI2-1 Protein 2e-64 53
aadA1 AGK36646.1 AadA1 aminoglycoside (3')(9) adenylyltransferase Not tested AbaR26 Protein 2e-64 53
aadA1 YP_005797133.1 aminoglycoside 3'-adenyltransferase Not tested AbaR4e Protein 2e-64 53
aadA1 YP_005797149.1 aminoglycoside 3'-adenyltransferase Not tested AbaR4e Protein 2e-64 53
aadA1 ACY75515.1 aminoglycoside adenyltransferase Not tested Tn6060 Protein 2e-64 53
aadA1 YP_006098376.1 aminoglycoside adenylyltransferase Not tested Tn2411 Protein 2e-64 53
aadA1 CAD92142.1 aminoglycoside adenyltransferase Not tested Not named Protein 2e-64 53
aadA1 ACN81025.1 AadA1 aminoglycoside (3')(9) adenylyltransferase Not tested AbaR5 Protein 2e-64 53
aadA1 CAJ77048.1 Aminoglycoside adenylyltransferase Not tested AbaR1 Protein 2e-64 53
aadA25 YP_005176241.1 aminoglycoside 3''-O-adenyltransferase protein Not tested ICEPmu1 Protein 1e-63 52
aadA2 AAK02046.1 streptomycin/spectinomycin resistance protein Not tested SGI1 Protein 3e-63 51
aadA2 AGF35027.1 AadA2 aminoglycoside adenylyltransferase Not tested SGI1 Protein 3e-63 51
aadA2 ACF06158.1 aminoglycoside 3''-adenyltransferase Not tested Tn5036-like Protein 3e-63 51
aadA1 AAL08435.1 streptomycin adenyltransferase AadA1 Not tested SRL Protein 2e-59 50
ant(9) NP_373289.1 O-nucleotidylltransferase(9) Not tested Type-II SCCmec Protein 1e-38 41
spc BAA82204.1 O-nucleotydiltransferase(9) Not tested Type-II SCCmec Protein 9e-39 41
spC YP_190051.1 streptomycin 3''-adenylyltransferase Not tested Type-II SCCmec Protein 1e-38 41
spc1 YP_039523.1 streptomycin 3''-adenylyltransferase 1 Not tested Type-II SCCmec Protein 1e-38 41
ant(9) NP_370577.1 O-nucleotidylltransferase Not tested Type-II SCCmec Protein 1e-38 41
ant(9) BAC57473.1 O-nucleotidyltransferase(9) Not tested Type-IIIinv SCCmec Protein 9e-39 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PSJM300_03550 YP_006523146.1 3''-adenylyltransferase NC_010558.1.6275994. Protein 1e-67 62
PSJM300_03550 YP_006523146.1 3''-adenylyltransferase DQ865198.gene.p01 Protein 1e-67 62
PSJM300_03550 YP_006523146.1 3''-adenylyltransferase AY139598.1.gene2.p01 Protein 5e-67 62
PSJM300_03550 YP_006523146.1 3''-adenylyltransferase U37105.2.gene4.p01 Protein 4e-65 57
PSJM300_03550 YP_006523146.1 3''-adenylyltransferase AJ628353.gene.p01 Protein 1e-49 55
PSJM300_03550 YP_006523146.1 3''-adenylyltransferase AJ704863.gene12.p01 Protein 2e-58 54
PSJM300_03550 YP_006523146.1 3''-adenylyltransferase AM932669.1.gene3.p01 Protein 3e-64 54
PSJM300_03550 YP_006523146.1 3''-adenylyltransferase AJ584652.2.gene7.p01 Protein 1e-63 53
PSJM300_03550 YP_006523146.1 3''-adenylyltransferase NC_010410.6003168.p0 Protein 1e-64 53
PSJM300_03550 YP_006523146.1 3''-adenylyltransferase JN596991.2.gene3.p01 Protein 1e-64 53
PSJM300_03550 YP_006523146.1 3''-adenylyltransferase FR748153.1.gene5.p01 Protein 1e-64 53
PSJM300_03550 YP_006523146.1 3''-adenylyltransferase AF313471.1.gene3.p01 Protein 1e-64 53
PSJM300_03550 YP_006523146.1 3''-adenylyltransferase AY339625.2.gene17.p0 Protein 1e-64 53
PSJM300_03550 YP_006523146.1 3''-adenylyltransferase Y18050.2.gene6.p01 Protein 1e-64 53
PSJM300_03550 YP_006523146.1 3''-adenylyltransferase AY123251.gene3.p01 Protein 1e-64 53
PSJM300_03550 YP_006523146.1 3''-adenylyltransferase NC_010410.6003170.p0 Protein 1e-64 53
PSJM300_03550 YP_006523146.1 3''-adenylyltransferase AF174129.3.gene3.p01 Protein 8e-63 52
PSJM300_03550 YP_006523146.1 3''-adenylyltransferase AF294653.1.gene3.p01 Protein 2e-62 52
PSJM300_03550 YP_006523146.1 3''-adenylyltransferase AF047479.2.orf1.gene Protein 4e-63 52
PSJM300_03550 YP_006523146.1 3''-adenylyltransferase AY263741.gene.p01 Protein 2e-61 51
PSJM300_03550 YP_006523146.1 3''-adenylyltransferase EU118119.1.orf1.gene Protein 2e-63 51
PSJM300_03550 YP_006523146.1 3''-adenylyltransferase NC_003198.gene.p01 Protein 9e-46 46
PSJM300_03550 YP_006523146.1 3''-adenylyltransferase NC_002745.1123578.p0 Protein 5e-39 41
PSJM300_03550 YP_006523146.1 3''-adenylyltransferase NC_002745.1124853.p0 Protein 5e-39 41
PSJM300_03550 YP_006523146.1 3''-adenylyltransferase NC_009782.5559472.p0 Protein 5e-39 41
PSJM300_03550 YP_006523146.1 3''-adenylyltransferase NC_002758.1120013.p0 Protein 5e-39 41
PSJM300_03550 YP_006523146.1 3''-adenylyltransferase NC_002952.2859153.p0 Protein 5e-39 41
PSJM300_03550 YP_006523146.1 3''-adenylyltransferase NC_002745.1122823.p0 Protein 5e-39 41
PSJM300_03550 YP_006523146.1 3''-adenylyltransferase NC_002745.1124325.p0 Protein 5e-39 41
PSJM300_03550 YP_006523146.1 3''-adenylyltransferase NC_002745.1125314.p0 Protein 5e-39 41
PSJM300_03550 YP_006523146.1 3''-adenylyltransferase GU235985.1.orf1.gene Protein 5e-39 41
PSJM300_03550 YP_006523146.1 3''-adenylyltransferase NC_009782.5559439.p0 Protein 5e-39 41
PSJM300_03550 YP_006523146.1 3''-adenylyltransferase NC_002758.1121631.p0 Protein 5e-39 41
PSJM300_03550 YP_006523146.1 3''-adenylyltransferase NC_002952.2859154.p0 Protein 5e-39 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PSJM300_03550 YP_006523146.1 3''-adenylyltransferase VFG1026 Protein 1e-59 50