Gene Information

Name : resD (HMPREF9154_0547)
Accession : YP_006510871.1
Strain : Propionibacterium propionicum F0230a
Genome accession: NC_018142
Putative virulence/resistance : Virulence
Product : transcriptional regulatory protein ResD
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 570785 - 571492 bp
Length : 708 bp
Strand : +
Note : -

DNA sequence :
ATGCATTCACATTCGGATGAGCAGCCCTACCCTGAGCCCATGGGAAACATCCTGCTCGTCGACGACGACCCGACCGTGCG
CGGTGTGGTCTCCGACTACCTGCGTGCAGCCGGGCACAGCATCACCGAGGCATCCGACGGGATCAGCGCCCTGGGACTCG
CCGACGGCTGCGACCTGGTGATCCTGGACCTCATGCTGCCCGGTATCGACGGCCTCGAGGTGTTCCGGCGGATCCGCTCC
CGCGGGGTGGTCGCACCGGTGATCATGCTCACCGCCAAGGGCTCGGAGGCCGACCGGGTGCTGGGCCTGGAACTCGGCGC
CGACGACTACCTGGCCAAACCGTTCAGCCCCCGCGAACTCGTGTTGAGGGTCAACGCGGTGCTGCGGCGACAGCAGCCCC
GGCCCGAACGGGAGATCATCACCGACGGCGACCTCGCCCTCGACCTAACAGCCCGGAAGGCCACCCTCGCGGGCGAGACG
CTGACGCTCACGCTCCGCGAGTTCGACCTGCTCGCCCACCTGGTAACCCATCCCGAGAAGGTCTTCTCCCGTGAGGAACT
GATGCGCGTGGTGTGGGGCTGGGACGTCGGCGACGCATCCACGGTGACGGTGCACGTGCGGCGGTTGCGCGGGAAGGTGG
AGCCCGACCCGCAGCATCCCACCCGGCTGGTGACGGTGTGGGGTCGCGGATACCGGTGGGAGGCCTAG

Protein sequence :
MHSHSDEQPYPEPMGNILLVDDDPTVRGVVSDYLRAAGHSITEASDGISALGLADGCDLVILDLMLPGIDGLEVFRRIRS
RGVVAPVIMLTAKGSEADRVLGLELGADDYLAKPFSPRELVLRVNAVLRRQQPRPEREIITDGDLALDLTARKATLAGET
LTLTLREFDLLAHLVTHPEKVFSREELMRVVWGWDVGDASTVTVHVRRLRGKVEPDPQHPTRLVTVWGRGYRWEA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 6e-35 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 7e-35 43
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 2e-24 42
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-24 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
resD YP_006510871.1 transcriptional regulatory protein ResD NC_012469.1.7685629. Protein 9e-37 48
resD YP_006510871.1 transcriptional regulatory protein ResD AE000516.2.gene3505. Protein 5e-33 48
resD YP_006510871.1 transcriptional regulatory protein ResD BAC0039 Protein 5e-31 43
resD YP_006510871.1 transcriptional regulatory protein ResD CP000034.1.gene2186. Protein 5e-31 43
resD YP_006510871.1 transcriptional regulatory protein ResD NC_002695.1.916589.p Protein 3e-31 43
resD YP_006510871.1 transcriptional regulatory protein ResD NC_002952.2859905.p0 Protein 2e-34 43
resD YP_006510871.1 transcriptional regulatory protein ResD NC_002745.1124361.p0 Protein 2e-34 43
resD YP_006510871.1 transcriptional regulatory protein ResD NC_009782.5559369.p0 Protein 2e-34 43
resD YP_006510871.1 transcriptional regulatory protein ResD NC_002951.3237708.p0 Protein 2e-34 43
resD YP_006510871.1 transcriptional regulatory protein ResD NC_002758.1121668.p0 Protein 2e-34 43
resD YP_006510871.1 transcriptional regulatory protein ResD NC_009641.5332272.p0 Protein 2e-34 43
resD YP_006510871.1 transcriptional regulatory protein ResD NC_013450.8614421.p0 Protein 2e-34 43
resD YP_006510871.1 transcriptional regulatory protein ResD NC_007793.3914279.p0 Protein 2e-34 43
resD YP_006510871.1 transcriptional regulatory protein ResD NC_007622.3794472.p0 Protein 2e-34 43
resD YP_006510871.1 transcriptional regulatory protein ResD CP000034.1.gene3671. Protein 9e-38 43
resD YP_006510871.1 transcriptional regulatory protein ResD NC_012469.1.7686381. Protein 5e-36 42
resD YP_006510871.1 transcriptional regulatory protein ResD HE999704.1.gene2815. Protein 2e-38 42
resD YP_006510871.1 transcriptional regulatory protein ResD BAC0596 Protein 3e-31 42
resD YP_006510871.1 transcriptional regulatory protein ResD CP001138.1.gene2239. Protein 3e-31 42
resD YP_006510871.1 transcriptional regulatory protein ResD CP001918.1.gene3444. Protein 1e-31 42
resD YP_006510871.1 transcriptional regulatory protein ResD BAC0197 Protein 9e-27 42
resD YP_006510871.1 transcriptional regulatory protein ResD NC_003923.1003749.p0 Protein 3e-34 42
resD YP_006510871.1 transcriptional regulatory protein ResD CP001918.1.gene5135. Protein 6e-19 42
resD YP_006510871.1 transcriptional regulatory protein ResD AF155139.2.orf0.gene Protein 2e-32 41
resD YP_006510871.1 transcriptional regulatory protein ResD CP001485.1.gene721.p Protein 3e-32 41
resD YP_006510871.1 transcriptional regulatory protein ResD CP004022.1.gene3215. Protein 8e-27 41
resD YP_006510871.1 transcriptional regulatory protein ResD CP000647.1.gene2531. Protein 4e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
resD YP_006510871.1 transcriptional regulatory protein ResD VFG1563 Protein 3e-35 43
resD YP_006510871.1 transcriptional regulatory protein ResD VFG1702 Protein 3e-35 43
resD YP_006510871.1 transcriptional regulatory protein ResD VFG1389 Protein 7e-25 43
resD YP_006510871.1 transcriptional regulatory protein ResD VFG0596 Protein 2e-24 41
resD YP_006510871.1 transcriptional regulatory protein ResD VFG1390 Protein 1e-27 41