Gene Information

Name : cusR (LPV_0839)
Accession : YP_006507933.1
Strain : Legionella pneumophila HL06041035
Genome accession: NC_018140
Putative virulence/resistance : Virulence
Product : DNA-binding response regulator in two-component regulatory system with CusS
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 839241 - 839912 bp
Length : 672 bp
Strand : -
Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; PubMedId : 11283292, 11399769, 20461235; Product type r : regulator

DNA sequence :
ATGCGATTATTAATTGTTGAAGACCATAAAAGAACGGCTGATTTTATCTGTAAAGGATTTAATGAATATCAATTTCAGGC
AGATGCTGTATACGATGGTGCAGAAGCAATCTATCGAATCTCAGAAATTAACTACGATGCTGTTGTTTTAGACGTTATGT
TACCCATAATGGATGGATGGACTGTACTTGAAAGGATTCGTGGACTAAAACCTGATTTACCTGTTTTAATGCTCTCTGCC
TGTGACGATGTTGATAGTCGTGTGAAAGGGCTTGAAATGGGTGCCTATGATTATCTTGTTAAACCTTTTTCCTTCAATGA
GCTCCTTGCCCGAGTAAAATCTTTACTACGAAGAAAACCCAAAGAGAGTCCTATCTTATTAAAGATTGATGATTTAACTC
TAAACTTACAAAAGCATACAGCAATACGAGGTGAAAAAAAGTTACCTCTAACAGCAAAAGAATTCATGTTATTGACGTTT
ATGTTGAGACGAAGTGGTGAAGTGCTTTCAAGGACAGTCATTGCTGAACAAGTTTGGGATATTAATTTTGACACGAATAC
CAATATCATTGATGTAGCGATCAAGCGTTTAAGGGAAAAAGTGGATAATGATCATCCTACTAAATTGATCCATACTGTCA
GAGGAGTAGGCTATGTATTGGAGATTCGCTAA

Protein sequence :
MRLLIVEDHKRTADFICKGFNEYQFQADAVYDGAEAIYRISEINYDAVVLDVMLPIMDGWTVLERIRGLKPDLPVLMLSA
CDDVDSRVKGLEMGAYDYLVKPFSFNELLARVKSLLRRKPKESPILLKIDDLTLNLQKHTAIRGEKKLPLTAKEFMLLTF
MLRRSGEVLSRTVIAEQVWDINFDTNTNIIDVAIKRLREKVDNDHPTKLIHTVRGVGYVLEIR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-45 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-44 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cusR YP_006507933.1 DNA-binding response regulator in two-component regulatory system with CusS BAC0197 Protein 2e-55 54
cusR YP_006507933.1 DNA-binding response regulator in two-component regulatory system with CusS BAC0125 Protein 2e-55 53
cusR YP_006507933.1 DNA-binding response regulator in two-component regulatory system with CusS BAC0083 Protein 1e-54 52
cusR YP_006507933.1 DNA-binding response regulator in two-component regulatory system with CusS BAC0111 Protein 1e-53 50
cusR YP_006507933.1 DNA-binding response regulator in two-component regulatory system with CusS BAC0308 Protein 2e-54 50
cusR YP_006507933.1 DNA-binding response regulator in two-component regulatory system with CusS BAC0638 Protein 8e-48 49
cusR YP_006507933.1 DNA-binding response regulator in two-component regulatory system with CusS BAC0347 Protein 3e-48 48

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cusR YP_006507933.1 DNA-binding response regulator in two-component regulatory system with CusS VFG0596 Protein 2e-45 46
cusR YP_006507933.1 DNA-binding response regulator in two-component regulatory system with CusS VFG1390 Protein 1e-38 42
cusR YP_006507933.1 DNA-binding response regulator in two-component regulatory system with CusS VFG1389 Protein 9e-33 42