Gene Information

Name : A225_R1p0555 (A225_R1p0555)
Accession : YP_006501536.1
Strain :
Genome accession: NC_018107
Putative virulence/resistance : Resistance
Product : MerP
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 31885 - 32160 bp
Length : 276 bp
Strand : -
Note : -

DNA sequence :
ATGAAAAAACTGTTTGCCGCCCTCGCCCTCGCTGCCGTTGTTGCCCCCGTGTGGGCCGCCACCCAGACCGTCACGCTGTC
CGTGCCTGGCATGACCTGCGCCTCTTGCCCGATCACTGTCAAGCACGCGCTTTCCAAGGTTGAGGGCGTGAGCAAGACCG
ACGTAAGTTTCGACAAGCGCCAGGCCGTCGTCACCTTCGACGATGCCAAGACCAACGTCCAGAAGTTGACCAAGGCGACC
GAGGACGCGGGCTATCCGTCCAGCCTCAAACGCTGA

Protein sequence :
MKKLFAALALAAVVAPVWAATQTVTLSVPGMTCASCPITVKHALSKVEGVSKTDVSFDKRQAVVTFDDAKTNVQKLTKAT
EDAGYPSSLKR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 1e-27 100
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 2e-27 100
merP AGK07081.1 MerP Not tested SGI1 Protein 1e-23 82
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 2e-23 82
merP ABQ57373.1 MerP Not tested SGI1 Protein 1e-23 82
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 1e-23 82
merP AFG30122.1 MerP Not tested PAGI-2 Protein 1e-23 82
merP AGK07023.1 MerP Not tested SGI1 Protein 1e-23 82
merP AAN62179.1 periplasmic mercuric ion binding protein MerP Not tested PAGI-2(C) Protein 8e-22 77
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 5e-23 75

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
A225_R1p0555 YP_006501536.1 MerP BAC0679 Protein 7e-24 85
A225_R1p0555 YP_006501536.1 MerP BAC0678 Protein 1e-23 84
A225_R1p0555 YP_006501536.1 MerP BAC0231 Protein 8e-24 82
A225_R1p0555 YP_006501536.1 MerP BAC0675 Protein 4e-22 77
A225_R1p0555 YP_006501536.1 MerP BAC0674 Protein 3e-17 62