Gene Information

Name : A225_R1p0895 (A225_R1p0895)
Accession : YP_006501532.1
Strain :
Genome accession: NC_018107
Putative virulence/resistance : Resistance
Product : MerE
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 29092 - 29328 bp
Length : 237 bp
Strand : -
Note : -

DNA sequence :
ATGAACAGCCCAGAGCACTTGCCGTCTGAGACGCACAAACCGATCACCGGCTACTTGTGGGGCGCGCTGGCCGTGCTCAC
CTGTCCCTGCCATTTGCCGATTCTCGCCATTGTGCTAGCCGGCACGACGGCCGGCGCGTTCATCGGGGAGCACTGGGGTA
TTGCAGCCCTCACGCTGACCGGCTTGTTTGTCCTGTCTGTGACGCGGCTGCTGCGGGCCTTCAAGGGAAGATCATGA

Protein sequence :
MNSPEHLPSETHKPITGYLWGALAVLTCPCHLPILAIVLAGTTAGAFIGEHWGIAALTLTGLFVLSVTRLLRAFKGRS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merE ACN81003.1 MerE Not tested AbaR5 Protein 3e-31 100
merE CAJ77058.1 Hypothetical protein Not tested AbaR1 Protein 2e-31 100
merE ABQ57369.1 MerE Not tested SGI1 Protein 4e-27 83
merE AGK07019.1 MerE Not tested SGI1 Protein 4e-27 83
merE AGK07077.1 MerE Not tested SGI1 Protein 4e-27 83
merE ACF06180.1 mercuric resistance protein Not tested Tn5036-like Protein 2e-27 82
merE AET25395.1 MerE Not tested PAGI-2(C) Protein 2e-27 82
merE AFG30118.1 MerE Not tested PAGI-2 Protein 2e-27 82
merE YP_006098385.1 putative mercury resistance protein Not tested Tn2411 Protein 3e-27 82

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
A225_R1p0895 YP_006501532.1 MerE BAC0672 Protein 3e-30 97
A225_R1p0895 YP_006501532.1 MerE BAC0670 Protein 5e-30 92
A225_R1p0895 YP_006501532.1 MerE BAC0673 Protein 2e-27 83
A225_R1p0895 YP_006501532.1 MerE BAC0671 Protein 2e-27 83