Gene Information

Name : A225_R1p1025 (A225_R1p1025)
Accession : YP_006501703.1
Strain :
Genome accession: NC_018107
Putative virulence/resistance : Resistance
Product : SMR family multidrug resistance protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 340603 - 340950 bp
Length : 348 bp
Strand : +
Note : -

DNA sequence :
ATGAAAGGCTGGCTTTTTCTTGTTATCGCAATAGTTGGCGAAGTAATCGCAACATCCGCATTAAAATCTAGCGAGGGCTT
TACTAAGCTTGCCCCTTCCGCCGTTGTCATAATCGGTTATGGCATCGCATTTTATTTTCTTTCTCTGGTTCTGAAATCCA
TCCCTGTCGGTGTTGCTTATGCAGTCTGGTCGGGACTCGGCGTCGTCATAATTACAGCCATTGCCTGGTTGCTTCATGGG
CAAAAGCTTGATGCGTGGGGCTTTGTAGGTATGGGGCTCATAATTGCTGCCTTTTTGCTCGCCCGATCCCCATCGTGGAA
GTCGCTGCGGAGGCCGACGCCATGGTGA

Protein sequence :
MKGWLFLVIAIVGEVIATSALKSSEGFTKLAPSAVVIIGYGIAFYFLSLVLKSIPVGVAYAVWSGLGVVIITAIAWLLHG
QKLDAWGFVGMGLIIAAFLLARSPSWKSLRRPTPW

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 2e-46 100
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 2e-46 100
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 2e-46 100
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 2e-46 100
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 2e-46 100
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 2e-46 100
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 2e-46 100
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 2e-46 100
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 2e-46 100
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 2e-46 100
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 2e-46 100
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 2e-46 100
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 2e-46 100
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 2e-46 100
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 2e-46 100
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 2e-46 100
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 2e-46 100
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 2e-46 100
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 2e-46 100
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 2e-46 100
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 2e-46 100
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 2e-46 100
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 2e-46 100
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 2e-46 100
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 2e-46 100
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 2e-46 100
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 2e-46 100
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 2e-46 100
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 2e-46 100
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 2e-46 100

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
A225_R1p1025 YP_006501703.1 SMR family multidrug resistance protein BAC0323 Protein 7e-47 100
A225_R1p1025 YP_006501703.1 SMR family multidrug resistance protein BAC0322 Protein 5e-38 89
A225_R1p1025 YP_006501703.1 SMR family multidrug resistance protein BAC0324 Protein 3e-31 72
A225_R1p1025 YP_006501703.1 SMR family multidrug resistance protein CP001138.1.gene1489. Protein 3e-18 56
A225_R1p1025 YP_006501703.1 SMR family multidrug resistance protein BAC0377 Protein 2e-17 54
A225_R1p1025 YP_006501703.1 SMR family multidrug resistance protein BAC0002 Protein 2e-21 51
A225_R1p1025 YP_006501703.1 SMR family multidrug resistance protein NC_010410.6003348.p0 Protein 2e-21 51
A225_R1p1025 YP_006501703.1 SMR family multidrug resistance protein CP004022.1.gene1549. Protein 2e-18 50
A225_R1p1025 YP_006501703.1 SMR family multidrug resistance protein BAC0329 Protein 4e-15 47
A225_R1p1025 YP_006501703.1 SMR family multidrug resistance protein BAC0327 Protein 5e-14 46
A225_R1p1025 YP_006501703.1 SMR family multidrug resistance protein AE000516.2.gene3301. Protein 5e-09 46
A225_R1p1025 YP_006501703.1 SMR family multidrug resistance protein BAC0249 Protein 5e-09 46
A225_R1p1025 YP_006501703.1 SMR family multidrug resistance protein BAC0325 Protein 3e-13 46
A225_R1p1025 YP_006501703.1 SMR family multidrug resistance protein BAC0192 Protein 2e-14 46
A225_R1p1025 YP_006501703.1 SMR family multidrug resistance protein NC_002695.1.913273.p Protein 2e-13 44
A225_R1p1025 YP_006501703.1 SMR family multidrug resistance protein BAC0150 Protein 1e-13 44
A225_R1p1025 YP_006501703.1 SMR family multidrug resistance protein BAC0139 Protein 2e-14 44
A225_R1p1025 YP_006501703.1 SMR family multidrug resistance protein BAC0140 Protein 3e-13 42
A225_R1p1025 YP_006501703.1 SMR family multidrug resistance protein BAC0321 Protein 3e-15 42
A225_R1p1025 YP_006501703.1 SMR family multidrug resistance protein BAC0326 Protein 3e-14 42