Gene Information

Name : A225_0342 (A225_0342)
Accession : YP_006496120.1
Strain : Klebsiella oxytoca E718
Genome accession: NC_018106
Putative virulence/resistance : Resistance
Product : Regulatory protein SoxS
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 360045 - 360374 bp
Length : 330 bp
Strand : -
Note : -

DNA sequence : 
ATGTCCCATCAGGATATTATCCAAACGCTTATTGAATGGATTGATGAACATATCGATCAACCACTTAACATTGATATAGT
CGCCAGAAAATCGGGATACTCGAAATGGTATCTGCAGCGGATGTTCCGCGCCGTGATGCATCAAACGCTGGGCGATTACA
TTCGCCAGCGCCGCCTGCTGCTCGCCGCGGAAGCGCTAAGAACCACTCAGCGCCCTATTTTTGATATCGCGATGGATCTC
GGCTACGTGTCGCAGCAAACCTTCTCGCGGGTGTTCCGTCGCGAATTTGACCGAACGCCGACCGCCTATCGCCATCAAAT
TTCTGCCTGA

Protein sequence : 
MSHQDIIQTLIEWIDEHIDQPLNIDIVARKSGYSKWYLQRMFRAVMHQTLGDYIRQRRLLLAAEALRTTQRPIFDIAMDL
GYVSQQTFSRVFRREFDRTPTAYRHQISA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 6e-35 88
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 1e-14 46
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 1e-14 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
A225_0342 YP_006496120.1 Regulatory protein SoxS CP000647.1.gene4499. Protein 6e-38 98
A225_0342 YP_006496120.1 Regulatory protein SoxS CP001918.1.gene327.p Protein 8e-37 90
A225_0342 YP_006496120.1 Regulatory protein SoxS CP001138.1.gene4488. Protein 2e-35 88
A225_0342 YP_006496120.1 Regulatory protein SoxS CP000034.1.gene4505. Protein 3e-34 86
A225_0342 YP_006496120.1 Regulatory protein SoxS BAC0371 Protein 1e-34 86
A225_0342 YP_006496120.1 Regulatory protein SoxS NC_002695.1.914293.p Protein 1e-34 86
A225_0342 YP_006496120.1 Regulatory protein SoxS CP001138.1.gene612.p Protein 7e-19 50
A225_0342 YP_006496120.1 Regulatory protein SoxS NC_010558.1.6276025. Protein 6e-15 46
A225_0342 YP_006496120.1 Regulatory protein SoxS CP000647.1.gene1624. Protein 2e-15 42
A225_0342 YP_006496120.1 Regulatory protein SoxS CP001918.1.gene2033. Protein 1e-15 42
A225_0342 YP_006496120.1 Regulatory protein SoxS CP001138.1.gene1637. Protein 1e-15 41
A225_0342 YP_006496120.1 Regulatory protein SoxS BAC0560 Protein 1e-15 41
A225_0342 YP_006496120.1 Regulatory protein SoxS NC_002695.1.917339.p Protein 1e-15 41
A225_0342 YP_006496120.1 Regulatory protein SoxS CP000034.1.gene1596. Protein 1e-15 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
A225_0342 YP_006496120.1 Regulatory protein SoxS VFG0585 Protein 2e-35 88
A225_0342 YP_006496120.1 Regulatory protein SoxS VFG1038 Protein 6e-15 46