Gene Information

Name : A225_1952 (A225_1952)
Accession : YP_006497682.1
Strain : Klebsiella oxytoca E718
Genome accession: NC_018106
Putative virulence/resistance : Resistance
Product : mercuric resistance operon coregulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2059530 - 2059892 bp
Length : 363 bp
Strand : -
Note : -

DNA sequence :
ATGAGCGCCTACACGGTATCGCAACTGGCCCATAACGCTGGGGTGAGCGTACATATCGTGCGCGACTACCTGGTGCGCGG
CTTGTTACGGCCGGTGGCCTGCACCACGGGCGGCTACGGCGTGTTCGACGATGCGGCCTTGCAACGGCTGTGCTTCGTGC
GCGCGGCCTTCGAGGCGGGTATCGGCCTGGATGCCCTGGCGCGGCTGTGCCGTGCGCTCGACGCAGCGGACGGCGCACAA
GCCGCAGCGCAGCTTACCGTGCTGCGCCAGTTGGTCGAGCGGCGGCGCGCGGCGTTGGCCCATCTGGACGCGCAACTGGC
CTCCATGCCAGCCGAGCGGGCGCACGAGGAGGCATTGCCGTGA

Protein sequence :
MSAYTVSQLAHNAGVSVHIVRDYLVRGLLRPVACTTGGYGVFDDAALQRLCFVRAAFEAGIGLDALARLCRALDAADGAQ
AAAQLTVLRQLVERRRAALAHLDAQLASMPAERAHEEALP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merD ACF06181.1 mercuric resistance protein Not tested Tn5036-like Protein 1e-35 99
merD AET25396.1 MerD Not tested PAGI-2(C) Protein 1e-35 99
merD AFG30119.1 MerD Not tested PAGI-2 Protein 1e-35 99
merD YP_006098386.1 MerR family transcriptional regulator Not tested Tn2411 Protein 2e-35 99
merD ACN81004.1 MerD Not tested AbaR5 Protein 7e-28 82
merD CAJ77059.1 Mercury operon coregulator protein Not tested AbaR1 Protein 1e-27 82
merD AGK07020.1 MerD Not tested SGI1 Protein 1e-28 81
merD AGK07078.1 MerD Not tested SGI1 Protein 1e-28 81
merD ABQ57370.1 MerD Not tested SGI1 Protein 2e-28 81

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
A225_1952 YP_006497682.1 mercuric resistance operon coregulator BAC0666 Protein 4e-29 82
A225_1952 YP_006497682.1 mercuric resistance operon coregulator BAC0227 Protein 9e-29 81
A225_1952 YP_006497682.1 mercuric resistance operon coregulator BAC0668 Protein 5e-29 81
A225_1952 YP_006497682.1 mercuric resistance operon coregulator BAC0665 Protein 1e-29 81
A225_1952 YP_006497682.1 mercuric resistance operon coregulator BAC0667 Protein 2e-30 80
A225_1952 YP_006497682.1 mercuric resistance operon coregulator BAC0669 Protein 5e-29 76