Gene Information

Name : SMUGS5_06830 (SMUGS5_06830)
Accession : YP_006490655.1
Strain : Streptococcus mutans GS-5
Genome accession: NC_018089
Putative virulence/resistance : Virulence
Product : response regulator CovR
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1448550 - 1449257 bp
Length : 708 bp
Strand : -
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGAAGAAAATTCTAATCGTTGACGATGAAAAACCAATTTCTGATATCATCAAGTTTAACTTGGCTAAGGAAGGTTATGA
CACGATTACAGCCTTTGATGGGCGTGAAGCATTAAGTAAATATGAAGAAGAAAATCCTGACTTGATTATATTGGACTTAA
TGTTACCAGAACTAGACGGTCTTGAAGTGGCTAAGGAAGTTAGAAAAAACAGCCATGTTCCAATTATTATGTTATCAGCT
AAAGACAGTGAGTTTGATAAGGTTATTGGTCTTGAAATTGGTGCTGATGATTATGTGACTAAACCTTTTTCTAATCGTGA
ATTACTGGCGCGTGTAAAAGCGCATCTTCGCCGTACTGAAAATATTGAATCCGCAGTGGCTGAGGAAAATGCTTCAGGTA
TACCTGAAATTATTATTGGGGACTTGCAAATCTTACCAGATGCTTTTGTTGCTAAAAAACGTGGAACAGAGGTAGAGTTA
ACTCACCGTGAGTTTGAGCTGTTGCATCACTTAGCGACACACACAGGTCAGGTGATGACGCGTGAACATTTACTTGAAAC
GGTTTGGGGCTATGATTATTTTGGAGATGTCCGTACTGTTGATGTTACTGTTCGTCGTCTGCGTGAAAAAATTGAAGATA
CACCTAGTCGTCCAGAGTACATTTTGACGCGACGCGGTGTTGGTTATTACATGAAATCATATGACTAA

Protein sequence :
MKKILIVDDEKPISDIIKFNLAKEGYDTITAFDGREALSKYEEENPDLIILDLMLPELDGLEVAKEVRKNSHVPIIMLSA
KDSEFDKVIGLEIGADDYVTKPFSNRELLARVKAHLRRTENIESAVAEENASGIPEIIIGDLQILPDAFVAKKRGTEVEL
THREFELLHHLATHTGQVMTREHLLETVWGYDYFGDVRTVDVTVRRLREKIEDTPSRPEYILTRRGVGYYMKSYD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 6e-32 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 5e-32 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SMUGS5_06830 YP_006490655.1 response regulator CovR NC_012469.1.7685629. Protein 3e-80 79
SMUGS5_06830 YP_006490655.1 response regulator CovR NC_002952.2859905.p0 Protein 6e-50 53
SMUGS5_06830 YP_006490655.1 response regulator CovR NC_007793.3914279.p0 Protein 7e-50 53
SMUGS5_06830 YP_006490655.1 response regulator CovR NC_002745.1124361.p0 Protein 7e-50 53
SMUGS5_06830 YP_006490655.1 response regulator CovR NC_009782.5559369.p0 Protein 7e-50 53
SMUGS5_06830 YP_006490655.1 response regulator CovR NC_002951.3237708.p0 Protein 7e-50 53
SMUGS5_06830 YP_006490655.1 response regulator CovR NC_003923.1003749.p0 Protein 6e-50 53
SMUGS5_06830 YP_006490655.1 response regulator CovR NC_002758.1121668.p0 Protein 7e-50 53
SMUGS5_06830 YP_006490655.1 response regulator CovR NC_007622.3794472.p0 Protein 5e-50 53
SMUGS5_06830 YP_006490655.1 response regulator CovR NC_009641.5332272.p0 Protein 7e-50 53
SMUGS5_06830 YP_006490655.1 response regulator CovR NC_013450.8614421.p0 Protein 7e-50 53
SMUGS5_06830 YP_006490655.1 response regulator CovR HE999704.1.gene2815. Protein 4e-50 53
SMUGS5_06830 YP_006490655.1 response regulator CovR NC_012469.1.7686381. Protein 5e-42 49
SMUGS5_06830 YP_006490655.1 response regulator CovR AE016830.1.gene1681. Protein 1e-43 47
SMUGS5_06830 YP_006490655.1 response regulator CovR FJ349556.1.orf0.gene Protein 7e-38 45
SMUGS5_06830 YP_006490655.1 response regulator CovR CP004022.1.gene3215. Protein 1e-31 45
SMUGS5_06830 YP_006490655.1 response regulator CovR CP001918.1.gene5135. Protein 4e-23 45
SMUGS5_06830 YP_006490655.1 response regulator CovR HE999704.1.gene1528. Protein 8e-31 44
SMUGS5_06830 YP_006490655.1 response regulator CovR AM180355.1.gene1830. Protein 1e-36 44
SMUGS5_06830 YP_006490655.1 response regulator CovR AF155139.2.orf0.gene Protein 2e-36 43
SMUGS5_06830 YP_006490655.1 response regulator CovR DQ212986.1.gene4.p01 Protein 5e-35 43
SMUGS5_06830 YP_006490655.1 response regulator CovR CP000034.1.gene3834. Protein 6e-28 43
SMUGS5_06830 YP_006490655.1 response regulator CovR NC_002695.1.915041.p Protein 6e-28 43
SMUGS5_06830 YP_006490655.1 response regulator CovR AE000516.2.gene3505. Protein 7e-33 42
SMUGS5_06830 YP_006490655.1 response regulator CovR NC_013450.8614146.p0 Protein 1e-35 42
SMUGS5_06830 YP_006490655.1 response regulator CovR NC_002951.3238224.p0 Protein 1e-35 42
SMUGS5_06830 YP_006490655.1 response regulator CovR NC_007793.3914065.p0 Protein 1e-35 42
SMUGS5_06830 YP_006490655.1 response regulator CovR NC_002758.1121390.p0 Protein 1e-35 42
SMUGS5_06830 YP_006490655.1 response regulator CovR NC_010079.5776364.p0 Protein 1e-35 42
SMUGS5_06830 YP_006490655.1 response regulator CovR AE015929.1.gene1106. Protein 7e-31 42
SMUGS5_06830 YP_006490655.1 response regulator CovR NC_002952.2859858.p0 Protein 1e-35 42
SMUGS5_06830 YP_006490655.1 response regulator CovR NC_007622.3794948.p0 Protein 1e-35 42
SMUGS5_06830 YP_006490655.1 response regulator CovR NC_003923.1003417.p0 Protein 1e-35 42
SMUGS5_06830 YP_006490655.1 response regulator CovR CP000647.1.gene4257. Protein 5e-28 42
SMUGS5_06830 YP_006490655.1 response regulator CovR CP001138.1.gene4273. Protein 9e-28 42
SMUGS5_06830 YP_006490655.1 response regulator CovR BAC0533 Protein 5e-28 42
SMUGS5_06830 YP_006490655.1 response regulator CovR CP001485.1.gene721.p Protein 2e-26 41
SMUGS5_06830 YP_006490655.1 response regulator CovR AF162694.1.orf4.gene Protein 2e-32 41
SMUGS5_06830 YP_006490655.1 response regulator CovR CP000034.1.gene2186. Protein 1e-28 41
SMUGS5_06830 YP_006490655.1 response regulator CovR NC_002695.1.916589.p Protein 1e-28 41
SMUGS5_06830 YP_006490655.1 response regulator CovR BAC0039 Protein 1e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SMUGS5_06830 YP_006490655.1 response regulator CovR VFG1389 Protein 6e-31 43
SMUGS5_06830 YP_006490655.1 response regulator CovR VFG1563 Protein 3e-32 42
SMUGS5_06830 YP_006490655.1 response regulator CovR VFG1702 Protein 2e-32 42