Gene Information

Name : PADK2_25915 (PADK2_25915)
Accession : YP_006485148.1
Strain : Pseudomonas aeruginosa DK2
Genome accession: NC_018080
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 5580489 - 5581178 bp
Length : 690 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence : 
ATGCGCATCCTGGTGATCGAAGACGATACGAAGACCGGCGAGTACCTGAAGAAGGGCCTCGGCGAGTCGGGCTATGCGGT
CGACTGGTCGCAGCACGGCGCCGACGGTCTCTACCTGGCGCTGGAGAACCGCTACGACCTGGTGGTCCTCGACGTGATGC
TGCCCGGCCTGGACGGTTGGCAGATCATGGAAGTGCTGCGCAAGAAGCACGATGTGCCGGTGCTCTTCCTCACCGCCCGC
GACCAGCTGCAAGACCGTATCCGCGGCCTCGAACTGGGTGCTGACGACTACCTGGTGAAACCCTTCTCCTTCACCGAGTT
GCTGCTGCGTATCCGTACCCTGCTGCGCCGCGGCGTGGTCCGCGAGGCAGAGCAGGTGCAACTGGCCGATCTGCAGCTGG
ACGTGCTGCGGCGCAAGGTCAGCCGCCAGGGGCAGGTGATCGCCCTGACCAACAAGGAGTTCGCCCTCCTGCACCTGCTG
ATGCGCCGCGAGGGCGAGGTGCTGTCGCGCACCCTGATCGCCTCGGAGGTCTGGGACATGAACTTCGACAGCGACACCAA
CGTCGTCGACGTGGCGATCAAGCGCCTGCGCGCCAAGGTCGACAATCCCTTCCCGAACAAGCTGATCCATACCGTGCGCG
GCATCGGTTACGTCTGCGAGGAGCGCCCGTGCCCGCCCGCCGCTCCCTGA

Protein sequence : 
MRILVIEDDTKTGEYLKKGLGESGYAVDWSQHGADGLYLALENRYDLVVLDVMLPGLDGWQIMEVLRKKHDVPVLFLTAR
DQLQDRIRGLELGADDYLVKPFSFTELLLRIRTLLRRGVVREAEQVQLADLQLDVLRRKVSRQGQVIALTNKEFALLHLL
MRREGEVLSRTLIASEVWDMNFDSDTNVVDVAIKRLRAKVDNPFPNKLIHTVRGIGYVCEERPCPPAAP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-50 57
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-49 57

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PADK2_25915 YP_006485148.1 two-component response regulator BAC0125 Protein 4e-57 64
PADK2_25915 YP_006485148.1 two-component response regulator BAC0197 Protein 5e-60 62
PADK2_25915 YP_006485148.1 two-component response regulator BAC0308 Protein 4e-52 60
PADK2_25915 YP_006485148.1 two-component response regulator BAC0083 Protein 3e-52 59
PADK2_25915 YP_006485148.1 two-component response regulator BAC0111 Protein 1e-52 58
PADK2_25915 YP_006485148.1 two-component response regulator BAC0638 Protein 2e-46 56
PADK2_25915 YP_006485148.1 two-component response regulator BAC0347 Protein 5e-46 53
PADK2_25915 YP_006485148.1 two-component response regulator AE000516.2.gene3505. Protein 6e-27 42
PADK2_25915 YP_006485148.1 two-component response regulator U82965.2.orf14.gene. Protein 4e-19 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PADK2_25915 YP_006485148.1 two-component response regulator VFG0596 Protein 1e-50 57
PADK2_25915 YP_006485148.1 two-component response regulator VFG1390 Protein 1e-29 44
PADK2_25915 YP_006485148.1 two-component response regulator VFG1389 Protein 8e-25 43
PADK2_25915 YP_006485148.1 two-component response regulator VFG0473 Protein 3e-21 42
PADK2_25915 YP_006485148.1 two-component response regulator VFG1386 Protein 3e-27 41