
|
Name : PADK2_25350 (PADK2_25350) Accession : YP_006485035.1 Strain : Pseudomonas aeruginosa DK2 Genome accession: NC_018080 Putative virulence/resistance : Virulence Product : two-component response regulator Function : - COG functional category : - COG ID : - EC number : - Position : 5465403 - 5466068 bp Length : 666 bp Strand : + Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain DNA sequence : ATGAGAATACTGCTGGCCGAGGACGACCTGCTGCTCGGCGACGGCATCCGCGCCGGGCTGCGCCTGGAAGGCGATACCGT GGAATGGGTGACCGACGGCGTGGCCGCGGAGAACGCGCTGGTCACCGACGAGTTCGACCTGCTGGTGCTCGACATCGGAC TGCCGCGCCGCAGCGGCCTGGACATCCTGCGTAACCTGCGCCACCAGGGCCGGCTCACCCCGGTGCTGCTGCTCACCGCG CGGGACAAGGTGGCCGACCGGGTCGCCGGGCTCGACAGCGGTGCCGACGACTACCTGACCAAGCCCTTCGATCTCGACGA ACTGCAGGCACGGGTGCGCGCCCTGACCCGCCGCACCACCGGTCGCGCCCTGCCGCAACTGGTGCACGGCGAGCTGCGCC TGGACCCGGCGACCCACCAGGTGACCCTGTCCGGGCAGGCGGTGGAACTGGCGCCGCGCGAATACGCACTGCTGCGCCTG CTGCTGGAGAACAGCGGCAAGGTGCTCTCGCGCAACCAACTGGAGCAGAGCCTCTACGGCTGGAGCGGCGACGTCGAGAG CAACGCCATCGAAGTCCACGTCCACCACCTGCGGCGCAAGCTCGGCAACCAGTTGATCCGCACCGTCCGCGGCATCGGCT ACGGCATCGACCAGCCGGCGCCCTGA Protein sequence : MRILLAEDDLLLGDGIRAGLRLEGDTVEWVTDGVAAENALVTDEFDLLVLDIGLPRRSGLDILRNLRHQGRLTPVLLLTA RDKVADRVAGLDSGADDYLTKPFDLDELQARVRALTRRTTGRALPQLVHGELRLDPATHQVTLSGQAVELAPREYALLRL LLENSGKVLSRNQLEQSLYGWSGDVESNAIEVHVHHLRRKLGNQLIRTVRGIGYGIDQPAP |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| armR | AAN62112.1 | putative response-regulator ArmR | Not tested | PAGI-2(C) | Protein | 4e-30 | 48 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| PADK2_25350 | YP_006485035.1 | two-component response regulator | BAC0487 | Protein | 2e-31 | 45 |
| PADK2_25350 | YP_006485035.1 | two-component response regulator | NC_002516.2.879194.p | Protein | 4e-22 | 42 |
| PADK2_25350 | YP_006485035.1 | two-component response regulator | NC_013450.8614146.p0 | Protein | 1e-24 | 42 |
| PADK2_25350 | YP_006485035.1 | two-component response regulator | NC_002951.3238224.p0 | Protein | 1e-24 | 42 |
| PADK2_25350 | YP_006485035.1 | two-component response regulator | NC_007793.3914065.p0 | Protein | 1e-24 | 42 |
| PADK2_25350 | YP_006485035.1 | two-component response regulator | NC_002758.1121390.p0 | Protein | 1e-24 | 42 |
| PADK2_25350 | YP_006485035.1 | two-component response regulator | NC_010079.5776364.p0 | Protein | 1e-24 | 42 |
| PADK2_25350 | YP_006485035.1 | two-component response regulator | NC_002952.2859858.p0 | Protein | 1e-24 | 42 |
| PADK2_25350 | YP_006485035.1 | two-component response regulator | NC_007622.3794948.p0 | Protein | 1e-24 | 42 |
| PADK2_25350 | YP_006485035.1 | two-component response regulator | NC_003923.1003417.p0 | Protein | 1e-24 | 42 |
| PADK2_25350 | YP_006485035.1 | two-component response regulator | BAC0308 | Protein | 4e-24 | 41 |
| PADK2_25350 | YP_006485035.1 | two-component response regulator | CP000647.1.gene4257. | Protein | 1e-19 | 41 |
| PADK2_25350 | YP_006485035.1 | two-component response regulator | BAC0533 | Protein | 1e-19 | 41 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| PADK2_25350 | YP_006485035.1 | two-component response regulator | VFG0473 | Protein | 4e-34 | 46 |
| PADK2_25350 | YP_006485035.1 | two-component response regulator | VFG1390 | Protein | 8e-30 | 43 |