Gene Information

Name : PADK2_19880 (PADK2_19880)
Accession : YP_006483949.1
Strain : Pseudomonas aeruginosa DK2
Genome accession: NC_018080
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4293202 - 4293510 bp
Length : 309 bp
Strand : -
Note : COG2963 Transposase and inactivated derivatives

DNA sequence :
ATGAGCAAGCAACGACGTACGTTTTCCGCCGAGTTCAAACGAGAGGCCGCGGCCCTGGTGTTGGACCAAGGCTACAGCTA
TATCGACGCCTGCCGTTCGCTGGGGGTGGTGGATTCGGCCTTGCGCCGTTGGGTGAAGCAGCTCGAGGCGGAGCGCCAGG
GTGTGACCCCGAAGAGCAAGGCGTTGACGCCTGAGCAGCAAAAGATCCAGGAGCTGGAAGCCCGGATCAACCGGTTGGAG
CGGGAGAAAGCGATATTAAAAAAGGCTACCGCTCTCTTGATGTCGGACGAACTCGATCGTACGCGCTGA

Protein sequence :
MSKQRRTFSAEFKREAAALVLDQGYSYIDACRSLGVVDSALRRWVKQLEAERQGVTPKSKALTPEQQKIQELEARINRLE
REKAILKKATALLMSDELDRTR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 4e-41 99
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 4e-21 57
l7045 CAD33744.1 - Not tested PAI I 536 Protein 1e-22 57
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 1e-22 57
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 2e-21 56
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 7e-22 56
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 7e-22 56
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 7e-22 56
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 7e-22 56
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-21 56
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 7e-22 56
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-21 56
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 7e-22 56
api80 CAF28554.1 putative transposase Not tested YAPI Protein 6e-18 54
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 5e-23 52
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 7e-23 52
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 2e-21 51
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 2e-21 51
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 2e-21 51
unnamed AAC31483.1 L0004 Not tested LEE Protein 1e-21 51
ORF SG13 AAN62235.1 conserved hypothetical protein Not tested PAGI-3(SG) Protein 9e-14 43
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 1e-10 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PADK2_19880 YP_006483949.1 hypothetical protein VFG1553 Protein 2e-21 57
PADK2_19880 YP_006483949.1 hypothetical protein VFG1485 Protein 4e-23 57
PADK2_19880 YP_006483949.1 hypothetical protein VFG1123 Protein 3e-22 56
PADK2_19880 YP_006483949.1 hypothetical protein VFG0784 Protein 6e-22 51
PADK2_19880 YP_006483949.1 hypothetical protein VFG1566 Protein 5e-11 41