Gene Information

Name : Desaci_2239 (Desaci_2239)
Accession : YP_006466530.1
Strain : Desulfosporosinus acidiphilus SJ4
Genome accession: NC_018068
Putative virulence/resistance : Resistance
Product : copper chaperone
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2308158 - 2308358 bp
Length : 201 bp
Strand : +
Note : PFAM: Heavy-metal-associated domain

DNA sequence :

ATGAGCCAAACCATTCTGAAAGTTGAAGGTATGACTTGCAATCATTGCAAAATGAGAACTGAAAAAGCGTTGCAAGCAGT
TAGTGGAGTTGAAAGCGTTAAGGTCGATCTTGAAGCTAAAGAAGCGGTTATTACGGGAAGCGCGGATCGTGCCAGTCTTG
TAAAAGCTGTTCAAGACGCAGGGTATACCGTGGTTGAATAA

Protein sequence :

MSQTILKVEGMTCNHCKMRTEKALQAVSGVESVKVDLEAKEAVITGSADRASLVKAVQDAGYTVVE

• Homologs from PAI DB

Gene	GenBank Accn	Product	Virulance or Resistance	PAI or REI	Alignment Type	E-val	Identity
merP	YP_006098389.1	mercuric ion transport protein	Not tested	Tn2411	Protein	2e-06	47
merP	ABQ57373.1	MerP	Not tested	SGI1	Protein	1e-06	47
merP	AET25399.1	MerP	Not tested	PAGI-2(C)	Protein	1e-06	47
merP	AFG30122.1	MerP	Not tested	PAGI-2	Protein	1e-06	47
merP	AGK07023.1	MerP	Not tested	SGI1	Protein	1e-06	47
merP	AGK07081.1	MerP	Not tested	SGI1	Protein	1e-06	47

• Homologs from CARD and BacMet (resistance genes)

Gene	GenBank Accn	Product	ID of source DB	Alignment Type	E-val	Identity
Desaci_2239	YP_006466530.1	copper chaperone	BAC0231	Protein	1e-07	44
Desaci_2239	YP_006466530.1	copper chaperone	BAC0675	Protein	1e-05	41