Gene Information

Name : Desaci_1915 (Desaci_1915)
Accession : YP_006466224.1
Strain : Desulfosporosinus acidiphilus SJ4
Genome accession: NC_018068
Putative virulence/resistance : Resistance
Product : putative stress response protein, TerZ- and CABP1
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1984218 - 1984796 bp
Length : 579 bp
Strand : +
Note : PFAM: Bacterial stress protein

DNA sequence :
ATGATTAGTTTGCAAAAAGGACAGAAAATTGATTTAACAAAAGGAAACCCGGGACTTTCCAAGATTATCGTTGGCCTGGG
CTGGGATACCAATAAATATTCAGGCAGGGCGGATTTCGATCTTGATGCTTCAGCCTTTCTGCTAGATCAAAATGGCAGGG
CTGGAGGAATTGAAGATTTCATCTTTTACAATAATCTCGTAGGTGGAGGAGGTTCCGTACAGCATACCGGTGATAACCTG
ACCGGAGAAGGTGAGGGCGATGATGAGCAAATCAAAGTTGATCTTGCCGCTGTGCCCAGTCATGTCGACAAGATTGCCTT
CACAGTAACGATTCACGAGGCAATTGCTCGCGGTCAAAACTTTGGGCAGGTCTCCAATGCCTATGTGCGGGTTATTAATG
AAGTTAGCGACCAAGAAATCATGCGCTACGACCTGGGAGAAGATTTTTCTGTTGAAACAGCTTTGGTCGTTTGTGAACTT
TACCGTCATCAGGGAGAATGGAGATTTAATGCGGTTGGGAGCGGATTTTCCGGAGGACTTGCAGCTTTATGCGCCAATTA
TGGCCTGCAGGCTGGCTGA

Protein sequence :
MISLQKGQKIDLTKGNPGLSKIIVGLGWDTNKYSGRADFDLDASAFLLDQNGRAGGIEDFIFYNNLVGGGGSVQHTGDNL
TGEGEGDDEQIKVDLAAVPSHVDKIAFTVTIHEAIARGQNFGQVSNAYVRVINEVSDQEIMRYDLGEDFSVETALVVCEL
YRHQGEWRFNAVGSGFSGGLAALCANYGLQAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-47 61
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-46 54
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-46 54
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 5e-46 53
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-40 51
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-38 48
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-38 48
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-38 48

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Desaci_1915 YP_006466224.1 putative stress response protein, TerZ- and CABP1 BAC0389 Protein 2e-45 53
Desaci_1915 YP_006466224.1 putative stress response protein, TerZ- and CABP1 BAC0390 Protein 1e-41 51