Gene Information

Name : Desaci_1914 (Desaci_1914)
Accession : YP_006466223.1
Strain : Desulfosporosinus acidiphilus SJ4
Genome accession: NC_018068
Putative virulence/resistance : Resistance
Product : putative stress response protein, TerZ- and CABP1
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1983582 - 1984160 bp
Length : 579 bp
Strand : +
Note : PFAM: Bacterial stress protein

DNA sequence :
ATGGCTATCAGTTTGCAAAAAGGTCAGAAAGTGGATTTAACGAAAGGAAATCCTGGTTTAAAAAAGATTGTTGTTGGTTT
GGGTTGGGACGTTAACAAGTATGATGGCGGCAATGACTTTGATCTCGATGCCTCGGCTTTTTTGTTAAATGCTGAAGGTA
AAGTGGCAGAAGATGGAAATTTTGTTTTCTTCAATAATACTTCAAGTCCTGAAGGTGCTGTTGTTCATACGGGAGATAAT
CGTTCCGGAGTGGGCGAGGGCGATGATGAGCAAATTAAAGTTGATCTTTCTTCAGTACCAAGCAGTGTTGCTAAGATTTC
TTTTGGAATTACTATTCATGAAGCCAAGGAGCGTCGCCAAAACTTCGGACAAGTTTCCAATTCTTATGTGCGGGTTCTCA
ATGAAGAGACAGGTGAAGAGATTATTCGCTATGATCTGGGTGAAGACTTTTCCGTTGAGACAGCCATCGTGGTAGGAGAA
CTTTATCGTAATAATGCAGAGTGGAAATTCAATGCTATCGGCAGCGGGTATCAGAATGGACTCGCCGGATTATGCAAGGA
TTTTGGCTTAGACGTCTAA

Protein sequence :
MAISLQKGQKVDLTKGNPGLKKIVVGLGWDVNKYDGGNDFDLDASAFLLNAEGKVAEDGNFVFFNNTSSPEGAVVHTGDN
RSGVGEGDDEQIKVDLSSVPSSVAKISFGITIHEAKERRQNFGQVSNSYVRVLNEETGEEIIRYDLGEDFSVETAIVVGE
LYRNNAEWKFNAIGSGYQNGLAGLCKDFGLDV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-57 61
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 6e-55 55
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-55 55
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-55 55
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-49 54
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-49 54
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-49 54
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-49 53

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Desaci_1914 YP_006466223.1 putative stress response protein, TerZ- and CABP1 BAC0390 Protein 6e-53 56
Desaci_1914 YP_006466223.1 putative stress response protein, TerZ- and CABP1 BAC0389 Protein 1e-54 55