Gene Information

Name : SSIL_2104 (SSIL_2104)
Accession : YP_006462673.1
Strain : Solibacillus silvestris StLB046
Genome accession: NC_018065
Putative virulence/resistance : Virulence
Product : response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2172195 - 2172866 bp
Length : 672 bp
Strand : +
Note : -

DNA sequence :
ATGAAAAAGAAGATTTTAATAATCGAAGACGAAAAAAATATAGCACGTTTCCTTGAACTGGAGCTTAAGCACGAGCAATT
TGAAACGGTTGTTGCATATGATGGGAGAACTGGTCTGGAATTGGCTGAAAGTGAACAATTCGACTGTATTTTGCTCGATG
TAATGCTACCGCAATTAAACGGGATTGAAGTATGTAGAAGAATACGAAAAACAAGCAATGTACCGATTCTCCTTATTACA
GCACGAGATGAAGTAATGGACCGCGTTTCAGGATTGGATGCGGGAGCAGATGATTATGTCGTGAAGCCTTTTGCGATAGA
AGAATTATTGGCACGGATCCGTTCAATCTTAAGGAGAGTGCAGCCTGCCCAAAAATCTAAACAACTCATTTTAAGGGAGT
TGGAAATCGACGTCGATGCTTATGAAGTAATATTTGAAAACAATAAAATCGAACTTACAAGAAAAGAATTTGATCTATTG
AAATTACTTGTGGAAAACAGAAACCTTGTATGTACAAGGGAGCGTATTTTAGAAGAGGTTTGGGGATTTGATACTGAGGT
AGAAACTAATGTAGTCGATGTATATATTCGCCATTTGCGTACAAAACTGCAAACAGAACATACTCCGTACATTGAAACAG
TACGTGGGGTTGGCTATGTGATGCGCGGGTGA

Protein sequence :
MKKKILIIEDEKNIARFLELELKHEQFETVVAYDGRTGLELAESEQFDCILLDVMLPQLNGIEVCRRIRKTSNVPILLIT
ARDEVMDRVSGLDAGADDYVVKPFAIEELLARIRSILRRVQPAQKSKQLILRELEIDVDAYEVIFENNKIELTRKEFDLL
KLLVENRNLVCTRERILEEVWGFDTEVETNVVDVYIRHLRTKLQTEHTPYIETVRGVGYVMRG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-35 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-34 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SSIL_2104 YP_006462673.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain HE999704.1.gene1528. Protein 4e-56 61
SSIL_2104 YP_006462673.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_010079.5776364.p0 Protein 3e-55 57
SSIL_2104 YP_006462673.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859858.p0 Protein 3e-55 57
SSIL_2104 YP_006462673.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794948.p0 Protein 3e-55 57
SSIL_2104 YP_006462673.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003417.p0 Protein 3e-55 57
SSIL_2104 YP_006462673.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614146.p0 Protein 3e-55 57
SSIL_2104 YP_006462673.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3238224.p0 Protein 3e-55 57
SSIL_2104 YP_006462673.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914065.p0 Protein 3e-55 57
SSIL_2104 YP_006462673.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121390.p0 Protein 3e-55 57
SSIL_2104 YP_006462673.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE015929.1.gene1106. Protein 6e-50 56
SSIL_2104 YP_006462673.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_012469.1.7685629. Protein 6e-44 46
SSIL_2104 YP_006462673.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0125 Protein 1e-39 46
SSIL_2104 YP_006462673.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0197 Protein 4e-37 46
SSIL_2104 YP_006462673.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859905.p0 Protein 2e-40 44
SSIL_2104 YP_006462673.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794472.p0 Protein 1e-40 44
SSIL_2104 YP_006462673.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121668.p0 Protein 1e-40 44
SSIL_2104 YP_006462673.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_009641.5332272.p0 Protein 1e-40 44
SSIL_2104 YP_006462673.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614421.p0 Protein 1e-40 44
SSIL_2104 YP_006462673.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914279.p0 Protein 1e-40 44
SSIL_2104 YP_006462673.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003749.p0 Protein 1e-40 44
SSIL_2104 YP_006462673.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002745.1124361.p0 Protein 1e-40 44
SSIL_2104 YP_006462673.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_009782.5559369.p0 Protein 1e-40 44
SSIL_2104 YP_006462673.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3237708.p0 Protein 1e-40 44
SSIL_2104 YP_006462673.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain HE999704.1.gene2815. Protein 3e-43 44
SSIL_2104 YP_006462673.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain HE999704.1.gene1202. Protein 2e-37 42
SSIL_2104 YP_006462673.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_012469.1.7686381. Protein 7e-42 42
SSIL_2104 YP_006462673.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0638 Protein 7e-33 42
SSIL_2104 YP_006462673.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0308 Protein 9e-36 41
SSIL_2104 YP_006462673.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0083 Protein 2e-36 41
SSIL_2104 YP_006462673.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE016830.1.gene1681. Protein 1e-41 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SSIL_2104 YP_006462673.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1390 Protein 3e-46 47
SSIL_2104 YP_006462673.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG0596 Protein 2e-35 44
SSIL_2104 YP_006462673.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1389 Protein 1e-35 42