Gene Information

Name : ykoG (SSIL_1670)
Accession : YP_006462239.1
Strain : Solibacillus silvestris StLB046
Genome accession: NC_018065
Putative virulence/resistance : Resistance
Product : response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1752480 - 1753184 bp
Length : 705 bp
Strand : -
Note : -

DNA sequence :
ATGTCTAAAATTTTGATTGTGGAAGATGAACAGCAGATCGCGCGTGTATTACAACTGGAGTTAGGGTTTGAAGGCTATGA
AACAACAATTGCCAATACCGGTACGGACGGTTTGCTGAAATTTCATGAAGACGAATATGATTTAGTGTTGCTTGATGTGA
TGCTTCCGGAGCTGAACGGCCTGGAAGTGCTGAAACGAATTCGCAAACATAATGAAACCGTTCCCGTTCTTTTACTGACT
GCTAAAAGCAATATTGAAGATAAAGTGACAGGGCTTGATTACGGGGCAAATGACTATATAACAAAGCCGTTTGAATTCGA
TGAACTGCTTGCACGAATTCGTGTTGCATTGCGATTTTCGCACAAATCTGCTCCAGAACCAACATCATCGTCTGTCCACA
CATTTCAGGACTTATCATTAAATGAGCAAACCCGAGAAGTCACAAGAAACGCGCTACAAATTGATTTGACTCCTCGTGAG
TTTGACTTGCTGCTGCATTTTATGAAGCACGCTAAACTTGTACAGTCACGTGAACAGCTGCTGAATGCGGTTTGGGGATA
TGACTATTATGGTGATACAAATGTTGTCGATGTATATGTCCGTTATTTGCGTCAAAAACTAGAGGTAAATCTGAATTTAC
CGCCACTACTACATACAGTTCGCGGTGTCGGCTATGTGTTAAAGGAAGCGTCAAATGAAACTTAA

Protein sequence :
MSKILIVEDEQQIARVLQLELGFEGYETTIANTGTDGLLKFHEDEYDLVLLDVMLPELNGLEVLKRIRKHNETVPVLLLT
AKSNIEDKVTGLDYGANDYITKPFEFDELLARIRVALRFSHKSAPEPTSSSVHTFQDLSLNEQTREVTRNALQIDLTPRE
FDLLLHFMKHAKLVQSREQLLNAVWGYDYYGDTNVVDVYVRYLRQKLEVNLNLPPLLHTVRGVGYVLKEASNET

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
nisR2 YP_006309922.1 NisR Not tested FWisland_1 Protein 2e-18 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ykoG YP_006462239.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE015929.1.gene1106. Protein 2e-39 48
ykoG YP_006462239.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914065.p0 Protein 4e-44 47
ykoG YP_006462239.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121390.p0 Protein 4e-44 47
ykoG YP_006462239.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_010079.5776364.p0 Protein 4e-44 47
ykoG YP_006462239.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859858.p0 Protein 4e-44 47
ykoG YP_006462239.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794948.p0 Protein 4e-44 47
ykoG YP_006462239.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003417.p0 Protein 4e-44 47
ykoG YP_006462239.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614146.p0 Protein 4e-44 47
ykoG YP_006462239.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3238224.p0 Protein 4e-44 47
ykoG YP_006462239.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain HE999704.1.gene1528. Protein 1e-44 47
ykoG YP_006462239.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0125 Protein 6e-39 45
ykoG YP_006462239.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0308 Protein 4e-40 44
ykoG YP_006462239.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_012469.1.7685629. Protein 3e-42 43
ykoG YP_006462239.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain HE999704.1.gene2815. Protein 9e-37 42
ykoG YP_006462239.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0197 Protein 2e-38 42
ykoG YP_006462239.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE000516.2.gene3505. Protein 1e-33 42
ykoG YP_006462239.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0347 Protein 2e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ykoG YP_006462239.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1386 Protein 1e-47 43
ykoG YP_006462239.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1389 Protein 2e-41 43
ykoG YP_006462239.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1390 Protein 8e-47 42