Gene Information

Name : yycF (SSIL_0134)
Accession : YP_006460703.1
Strain : Solibacillus silvestris StLB046
Genome accession: NC_018065
Putative virulence/resistance : Virulence
Product : response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 166011 - 166724 bp
Length : 714 bp
Strand : +
Note : -

DNA sequence :
ATGATGGATAAAACGATATTAGTTGTAGACGATGAAAAACCGATTGCAGATATTTTGCAGTTTAATTTAATAAAAGAAGG
TTATCGCGTCATTTGTGCATACGATGGGGACGAAGCGCTTCAAAGAGTAGAAGAGGAACAGCCGGATTTAATGTTGCTGG
ATATTATGTTACCTAAACGTGACGGCATGGAAGTATGTCGTGAAGTGCGCAAAAAATATGATTTCCCAATTATTATGCTA
ACGGCAAAAGGGTCGGAAATCGATAAAGTGCTAGGACTGGAAATGGGTGCTGACGATTATGTAACAAAGCCGTTCAGTAC
ACGTGAACTAATCGCCCGTGTAAAAGCGAATATGCGCAGATTAAATGTGCCTGCTCAAATAGAAGAAGCACAGGCGGAAA
CGAATGATATTGTAGTAGGCTCTTTAACAATTCAGCCAGATGCCTATTTAGTATTAAAGCGTGACGAGTCAATTGAATTA
ACACACCGCGAATTTGAATTACTGCATTATTTAGCAAAACATATTGGTCAAGTAATGACGCGTGAGCATTTGCTGCAAAC
AGTATGGGGTTATGATTATTTCGGTGATGTACGAACAGTGGATGTAACAATCCGCCGTTTACGTGAAAAAATTGAAGATA
ATCCAAGTCACCCTTTATGGATTGTTACGAGACGAGGAGTAGGCTATTACTTACGAAACCCTGAACAGGAGTAA

Protein sequence :
MMDKTILVVDDEKPIADILQFNLIKEGYRVICAYDGDEALQRVEEEQPDLMLLDIMLPKRDGMEVCREVRKKYDFPIIML
TAKGSEIDKVLGLEMGADDYVTKPFSTRELIARVKANMRRLNVPAQIEEAQAETNDIVVGSLTIQPDAYLVLKRDESIEL
THREFELLHYLAKHIGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIEDNPSHPLWIVTRRGVGYYLRNPEQE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-35 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 8e-35 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yycF YP_006460703.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_012469.1.7685629. Protein 7e-71 65
yycF YP_006460703.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614421.p0 Protein 5e-60 55
yycF YP_006460703.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914279.p0 Protein 5e-60 55
yycF YP_006460703.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859905.p0 Protein 7e-60 55
yycF YP_006460703.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003749.p0 Protein 3e-60 55
yycF YP_006460703.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002745.1124361.p0 Protein 5e-60 55
yycF YP_006460703.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_009782.5559369.p0 Protein 5e-60 55
yycF YP_006460703.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3237708.p0 Protein 5e-60 55
yycF YP_006460703.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794472.p0 Protein 4e-60 55
yycF YP_006460703.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121668.p0 Protein 5e-60 55
yycF YP_006460703.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_009641.5332272.p0 Protein 5e-60 55
yycF YP_006460703.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain HE999704.1.gene2815. Protein 6e-51 51
yycF YP_006460703.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_012469.1.7686381. Protein 2e-46 50
yycF YP_006460703.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE016830.1.gene1681. Protein 3e-49 47
yycF YP_006460703.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain FJ349556.1.orf0.gene Protein 1e-41 46
yycF YP_006460703.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AF155139.2.orf0.gene Protein 2e-40 45
yycF YP_006460703.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AM180355.1.gene1830. Protein 5e-42 44
yycF YP_006460703.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AE000516.2.gene3505. Protein 7e-38 44
yycF YP_006460703.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_003923.1003417.p0 Protein 1e-37 42
yycF YP_006460703.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_013450.8614146.p0 Protein 1e-37 42
yycF YP_006460703.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002951.3238224.p0 Protein 1e-37 42
yycF YP_006460703.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007793.3914065.p0 Protein 1e-37 42
yycF YP_006460703.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002758.1121390.p0 Protein 1e-37 42
yycF YP_006460703.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_010079.5776364.p0 Protein 1e-37 42
yycF YP_006460703.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002952.2859858.p0 Protein 1e-37 42
yycF YP_006460703.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_007622.3794948.p0 Protein 1e-37 42
yycF YP_006460703.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AF130997.1.orf0.gene Protein 9e-40 42
yycF YP_006460703.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_014475.1.orf0.gen Protein 2e-41 42
yycF YP_006460703.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_005054.2598277.p0 Protein 2e-41 42
yycF YP_006460703.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain AF162694.1.orf4.gene Protein 2e-35 42
yycF YP_006460703.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain DQ212986.1.gene4.p01 Protein 9e-42 42
yycF YP_006460703.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain CP001918.1.gene5135. Protein 2e-31 42
yycF YP_006460703.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain CP004022.1.gene3215. Protein 2e-38 42
yycF YP_006460703.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain HE999704.1.gene1528. Protein 1e-31 41
yycF YP_006460703.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain EU250284.1.orf4.gene Protein 3e-38 41
yycF YP_006460703.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002695.1.915041.p Protein 5e-34 41
yycF YP_006460703.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0533 Protein 2e-34 41
yycF YP_006460703.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain CP000034.1.gene3834. Protein 5e-34 41
yycF YP_006460703.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain CP000647.1.gene4257. Protein 2e-34 41
yycF YP_006460703.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain NC_002695.1.916589.p Protein 1e-31 41
yycF YP_006460703.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain BAC0039 Protein 1e-31 41
yycF YP_006460703.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain CP000034.1.gene2186. Protein 1e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yycF YP_006460703.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1563 Protein 8e-36 42
yycF YP_006460703.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1702 Protein 3e-35 42
yycF YP_006460703.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1389 Protein 8e-31 42
yycF YP_006460703.1 response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain VFG1390 Protein 6e-35 41