Gene Information

Name : A458_08670 (A458_08670)
Accession : YP_006457403.1
Strain : Pseudomonas stutzeri CCUG 29243
Genome accession: NC_018028
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1874727 - 1875128 bp
Length : 402 bp
Strand : +
Note : COG0789 Predicted transcriptional regulators

DNA sequence :
ATGCCACTCACCATCGGCAAACTCAGCAAGGCCACGGCAGTGAACGTGGAGACCATCCGCTATTACGAGCGCATCGGGCT
GCTTGCGGCGCCGTCGCGCACCGAATCCGGCTATCGCACGTTCAGCGAGCAGGACGCCGCGCGGCTGCGTTTCATCAAGC
GTGGGCGGGAGCTGGGGTTTTCCCTCGACGAGATCCGCACCATGGTCGAGCTGGCCGACCAGCCCGAGCATGCCTGCACC
GATGTCGATCGCCTGGTGCAGACGCATCTGGTCGAAGTGCGCCAGCGCATCGCCGATCTGCAGCGGCTCGAAGCGGAGCT
GCAGCGCTTGGCGGGCTGCAGCGAATCGTCGGTCCGCGAGTGCCGCATCATCGAAACCCTGACGGGAGTGCGTCGGCCCT
AG

Protein sequence :
MPLTIGKLSKATAVNVETIRYYERIGLLAAPSRTESGYRTFSEQDAARLRFIKRGRELGFSLDEIRTMVELADQPEHACT
DVDRLVQTHLVEVRQRIADLQRLEAELQRLAGCSESSVRECRIIETLTGVRRP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed BAB47646.1 orf2 Not tested Type-III SCCmec Protein 1e-22 46
SE0081 NP_763636.1 hypothetical protein Not tested SCCpbp4 Protein 1e-22 46
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 4e-21 42
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 6e-21 42
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 6e-23 41
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 2e-19 41
merR AGK07025.1 MerR Not tested SGI1 Protein 2e-20 41
merR AGK07083.1 MerR Not tested SGI1 Protein 2e-20 41
merR ACK44535.1 MerR Not tested SGI1 Protein 8e-21 41
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 8e-21 41
merR AFG30124.1 MerR Not tested PAGI-2 Protein 8e-21 41
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 1e-20 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
A458_08670 YP_006457403.1 MerR family transcriptional regulator BAC0682 Protein 2e-23 45
A458_08670 YP_006457403.1 MerR family transcriptional regulator BAC0680 Protein 1e-22 45
A458_08670 YP_006457403.1 MerR family transcriptional regulator BAC0688 Protein 6e-23 43
A458_08670 YP_006457403.1 MerR family transcriptional regulator BAC0462 Protein 2e-23 42
A458_08670 YP_006457403.1 MerR family transcriptional regulator BAC0687 Protein 2e-21 42
A458_08670 YP_006457403.1 MerR family transcriptional regulator BAC0684 Protein 1e-21 42
A458_08670 YP_006457403.1 MerR family transcriptional regulator BAC0232 Protein 2e-21 42
A458_08670 YP_006457403.1 MerR family transcriptional regulator BAC0683 Protein 1e-21 42
A458_08670 YP_006457403.1 MerR family transcriptional regulator BAC0182 Protein 4e-27 42
A458_08670 YP_006457403.1 MerR family transcriptional regulator BAC0689 Protein 1e-20 41