Gene Information

Name : A458_06630 (A458_06630)
Accession : YP_006456995.1
Strain : Pseudomonas stutzeri CCUG 29243
Genome accession: NC_018028
Putative virulence/resistance : Resistance
Product : regulatory protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1456517 - 1456924 bp
Length : 408 bp
Strand : +
Note : COG0789 Predicted transcriptional regulators

DNA sequence : 
ATGCGCATTGGTCAGTTGGCGCAGTTGGTAGGGGTCGAAACACAGACGATCCGCTTCTATGAACAGCAGGGCTTGTTGCC
GCCGCCTGATCGGCAGGACAACGGTTACCGTGTCTATACCGAGAAGCATGGTGAGGGGCTGGCCTTCATCCGTCGCTGCA
GAATCCTGGGCCTGTCACTGGCTGAGATTCACGAACTACAGAGCTATGAGGACGACCCTCATCAGCCTTGTACCGCCGTC
AACGCCTTGCTCGATGATCACATCTCTCATGTGCGGTCGCAGATAACCGCTCTGCAAGCGCTTGAGAAACAACTCGTTTC
ACTGAGAGCGAGTTGCAACGATGACCGGGAAGTTGAGGCGTGTGGGGTTCTTGCTGGAATTAGCGAAGGAAACATGCACC
AGCAGTAG

Protein sequence : 
MRIGQLAQLVGVETQTIRFYEQQGLLPPPDRQDNGYRVYTEKHGEGLAFIRRCRILGLSLAEIHELQSYEDDPHQPCTAV
NALLDDHISHVRSQITALQALEKQLVSLRASCNDDREVEACGVLAGISEGNMHQQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ACICU_00234 YP_001844893.1 transcriptional regulator Not tested AbaR20 Protein 3e-54 90
pbrR CAJ77094.1 Transcriptional regulator Not tested AbaR1 Protein 2e-54 90
cadR AGK36653.1 MerR family transcriptional regulator Not tested AbaR26 Protein 2e-54 90
cadR ACN81029.1 MerR family transcriptional regulator Not tested AbaR5 Protein 3e-54 90
cadR ACS32041.1 MerR family transcriptional regulator Not tested AbaR5 Protein 7e-54 89
cadR ADZ05769.1 MerR family transcriptional regulator Not tested AbaR11 Protein 5e-54 89
pbrR CAJ77021.1 transcription regulator Not tested AbaR1 Protein 3e-54 89
ORF C98 AAN62191.1 putative transcriptional regulator Not tested PAGI-2(C) Protein 4e-29 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
A458_06630 YP_006456995.1 regulatory protein BAC0301 Protein 1e-23 47
A458_06630 YP_006456995.1 regulatory protein BAC0058 Protein 3e-28 47