Gene Information

Name : Mycch_4183 (Mycch_4183)
Accession : YP_006454579.1
Strain : Mycobacterium chubuense NBB4
Genome accession: NC_018027
Putative virulence/resistance : Resistance
Product : glutaredoxin-dependent arsenate reductase
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4391941 - 4392291 bp
Length : 351 bp
Strand : +
Note : PFAM: ArsC family; TIGRFAM: arsenate reductase (glutaredoxin)

DNA sequence :
ATGGCACAGGCAGAGACCCGGATCTACCACAACCCGAAGTGCTCGACGTCGCGCAAGACCCTGGAGTTGTTGCGGGACAA
CGGCATCGACCCCGAGGTGGTGCTCTACCTGAAGAACCCGCCGACGCGCGACGAGCTGGCGACAATGATCGCCGACGCCG
GGATCGATGTGCGCACCGCCGTCCGCAAGCGCGAATCCCTCTACGAGGAACTGGGATTGGCGTCGGCGTCCGACGACGAG
CTGCTCGACGCGATGGCCGAACATCCCATCCTGATCGAGCGCCCGTTCGTCGTGACGCCCAGGGGCACCAGGCTGGCACG
GCCCCTCGACTCGGTCCGAGAGATTCTGTGA

Protein sequence :
MAQAETRIYHNPKCSTSRKTLELLRDNGIDPEVVLYLKNPPTRDELATMIADAGIDVRTAVRKRESLYEELGLASASDDE
LLDAMAEHPILIERPFVVTPRGTRLARPLDSVREIL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
arsC2 YP_001007634.1 arsenate reductase Not tested YAPI Protein 4e-27 57
arsC ADZ05768.1 arsenate reductase Not tested AbaR11 Protein 2e-27 53
arsC AFC76436.1 ArsC Not tested AbaR5 Protein 1e-27 53
arsR CAJ77019.1 arsenate reductase Not tested AbaR1 Protein 9e-28 53

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mycch_4183 YP_006454579.1 glutaredoxin-dependent arsenate reductase BAC0583 Protein 5e-29 58
Mycch_4183 YP_006454579.1 glutaredoxin-dependent arsenate reductase BAC0584 Protein 9e-28 57
Mycch_4183 YP_006454579.1 glutaredoxin-dependent arsenate reductase BAC0585 Protein 1e-27 57
Mycch_4183 YP_006454579.1 glutaredoxin-dependent arsenate reductase BAC0582 Protein 6e-29 57