Gene Information

Name : Turpa_0921 (Turpa_0921)
Accession : YP_006439077.1
Strain : Turneriella parva DSM 21527
Genome accession: NC_018020
Putative virulence/resistance : Resistance
Product : GCN5-related N-acetyltransferase
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 941004 - 941486 bp
Length : 483 bp
Strand : -
Note : PFAM: Acetyltransferase (GNAT) family; InterPro IPR000182; KEGG: pde:Pden_3355 gentamicin 3'-N-acetyltransferase; PFAM: GCN5-related N-acetyltransferase; SPTR: Gentamicin 3'-N-acetyltransferase

DNA sequence :
ATGAGTAATGCGCCGGCCACAAACTTAACCTTTGCCGTCCGCCGACTGGGGCGTGGCGATGTCGGTGCATTCCGCGAGCT
CAACCGGCTCTTTGCCGAGGCCTTCGACGATGCCGTCCACTACCAGCAGGCGCCGCCATCAGATGCTTATCTGCAGGCAC
TGCTGGCCAAACCGCATGTCATTGCCCTCGTTACTCTAGTCGAAGGAAAAATGGCCGGTGGTCTCGTCGCCTACGTGCTC
GATAAATTTGAAAAGGAGCGCAGCGAAGTGTATATTTACGATCTCGCGGTGCTTGAGCAATTCAGGCGCCGCGGCATTGC
GCGGTCGCTTATTGTTGAACTCAAGAAAATCGCCGCTGATATTGGTGCATGGGTAATATATGTTCAAGCCGACAAAAACG
CAGAAGATTTTCCGGCGCGGCAGCTTTATGAATCAATGGGTGAGCGAGAAGATGTTTTTCATTACGATATCGCTATAGAT
TAA

Protein sequence :
MSNAPATNLTFAVRRLGRGDVGAFRELNRLFAEAFDDAVHYQQAPPSDAYLQALLAKPHVIALVTLVEGKMAGGLVAYVL
DKFEKERSEVYIYDLAVLEQFRRRGIARSLIVELKKIAADIGAWVIYVQADKNAEDFPARQLYESMGEREDVFHYDIAID

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
acc(3)Ic ACY75521.1 Aac(3) Ic Not tested Tn6060 Protein 3e-32 53
aacCA5 AGK06931.1 aminoglycoside acetyltransferase Not tested SGI1 Protein 8e-32 50
aacCA5 AGK06968.1 aminoglycoside acetyltransferase Not tested SGI1 Protein 8e-32 50
aacCA5 AGK07014.1 aminoglycoside acetyltransferase Not tested SGI1 Protein 8e-32 50
aacCA5 AGK07072.1 aminoglycoside acetyltransferase Not tested SGI1 Protein 8e-32 50
aacCA5 AAR21853.1 aminoglycoside (3) acetyltransferase; AacCA5 or AAC(3)-Ie Not tested SGI1 Protein 8e-32 50
aacCA5 AGF35061.1 aminoglycoside acetyltransferase Not tested SGI1 Protein 8e-32 50
aacC1/aacCA1 ACV89836.1 type A aminoglycoside-(3)-acetyltransferase AacC1 or AacC-A1 or AAC-(3)-Ia Not tested AbaR7 Protein 6e-26 48
aacC1 AFV53117.1 aminoglycoside (3) acetyltransferase AacC1 or AacC-A1 or AAC(3)-Ia Not tested AbGRI2-1 Protein 6e-26 48
aacCA1 AGK36643.1 aminoglycoside-(3)-acetyltransferase AacC1 or AacC-A1 or AAC-(3)-Ia Not tested AbaR26 Protein 6e-26 48
aacC1/aacCA1 ACN81021.1 aminoglycoside-(3)-acetyltransferase AacC1 or AacC-A1 or AAC-(3)-Ia Not tested AbaR5 Protein 9e-26 48
aac3 CAJ77083.1 Aminoglycoside 3-acetyltransferase Not tested AbaR1 Protein 6e-26 48
aacC1/aacCA1 ACV89833.1 type A aminoglycoside-(3)-acetyltransferase AacC-A1 or AacC1 or AAC-(3)-Ia Not tested AbaR7 Protein 6e-26 48
aacC1 AFV53118.1 aminoglycoside (3) acetyltransferase AacC1 or AacC-A1 or AAC(3)-Ia Not tested AbGRI2-1 Protein 6e-26 48
aacC1 YP_005797146.1 aminoglycoside N(3')-acetyltransferase I Not tested AbaR4e Protein 8e-26 48
aacC1/aacCA1 ACN81020.1 aminoglycoside-(3)-acetyltransferase AacC-A1 or AacC1 or AAC-(3)-Ia Not tested AbaR5 Protein 8e-26 48

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Turpa_0921 YP_006439077.1 GCN5-related N-acetyltransferase AF318077.1.gene3.p01 Protein 2e-26 49
Turpa_0921 YP_006439077.1 GCN5-related N-acetyltransferase NC_010410.6002585.p0 Protein 3e-26 48
Turpa_0921 YP_006439077.1 GCN5-related N-acetyltransferase NC_011586.7045205.p0 Protein 3e-26 48
Turpa_0921 YP_006439077.1 GCN5-related N-acetyltransferase U04610.gene.p01 Protein 6e-26 47