Gene Information

Name : Fleli_0813 (Fleli_0813)
Accession : YP_006433065.1
Strain : Flexibacter litoralis DSM 6794
Genome accession: NC_018018
Putative virulence/resistance : Resistance
Product : stress response protein, TerZ- and CABP1
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 920022 - 920582 bp
Length : 561 bp
Strand : -
Note : PFAM: Bacterial stress protein

DNA sequence :
ATGGCTATTTCATTAAAAAAAGGAGGACGTTTCAACCTCTCTAAAAACGAACCTAGTTTAGAAAAAATAATGGTCGGACT
TGGCTGGGAAATGAAATCAGGTGCAAAATTAGACCTTGATGTTTCTGTATTTATGGTAGGAGCTTCGGGCAAAGTGCCTG
CCGATGAGTATTTTGTTTTTTACAATAATCTCAAATCTCCAGATGGTTCTATTCAACACACAGGAGACAACCGAACAGGT
GATGGAGATGGAGATGATGAAATGGTTTTGGCTAACTTGCCTTTAGTTTCCTCGGATGTAAATGAACTTATTTTTGTTGC
TTCTATTCATGAAGCTGCTACTCGTCGTCATAATTTTGGAATGTTAGAAGATGCGTATATCAGAATTGTAGATGTGAGTT
CGGATAGAGAAATATTGCGCTACGATTTGGATGCTGAGTTTGCTTCAAATACAGATGTAGAATTTGGTAGATTAATTAGA
GAAAATGGAGAATGGTCATTTGTAGCCTCTGGATTGGGTGAAAATGGTGGTTTGCAAGCATTTTTGGATAAATACGCTTA
A

Protein sequence :
MAISLKKGGRFNLSKNEPSLEKIMVGLGWEMKSGAKLDLDVSVFMVGASGKVPADEYFVFYNNLKSPDGSIQHTGDNRTG
DGDGDDEMVLANLPLVSSDVNELIFVASIHEAATRRHNFGMLEDAYIRIVDVSSDREILRYDLDAEFASNTDVEFGRLIR
ENGEWSFVASGLGENGGLQAFLDKYA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 6e-42 51
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-39 49
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-39 49
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 9e-39 48
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-35 46
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-35 46
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 7e-36 46
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-36 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Fleli_0813 YP_006433065.1 stress response protein, TerZ- and CABP1 BAC0389 Protein 2e-40 50
Fleli_0813 YP_006433065.1 stress response protein, TerZ- and CABP1 BAC0390 Protein 8e-40 49